Identifiers and Description

Gene Model Identifier

TTHERM_00585450

Standard Name

ERI2 (ExoRIbonuclease 2)

Aliases

PreTt04151 | 80.m00197 | 3675.m00095

Description

ERI2 ERI1 exoribonuclease

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

  • ( SD02004 ) Macronucleus: Δeri2 complete ko
  • ( SD02024 ) Macronucleus: Δeri2 complete ko

Homologs

Source Identifier Score
Tetrahymena borealis EI9_15156.1 2.0004683842646898e-122
Description: exonuclease (216 aa)
Oxytricha Contig3963.0.g42 1.9999167998962255e-60
Description: RNA 2-phosphotransferase, Tpt1 / KptA family
WormBase WBGene00019825 6.998837695286184e-44
Description: status:Confirmed UniProt:Q9TZZ9 protein_id:CCD73172.1
DictyBase DDB_G0283113 1.000159011384939e-43
Description: eriA on chromosome: 4 position 263707 to 264369
Stentor Coeruleus SteCoe_23725 2.8625185805493937e-20
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00585450(coding)
ATGGACTAAAAAAATTAAATTAACAATGATTTTGACTATTTACTGATATTAGATTTCGAA
GCTACTTGCGAAAAAAATGTTAAATTAGAATGTTAAGAAATAATAGAATTTCCTGTTGTT
GTTTTAGATGTTAAAAACTAATAAATATTAGATGTCTTTTTCCATCATTATATAAAGCCT
TCTGTAAATCCTAAACTCACAGCTTTTTGCACAGAATTAACTGGAATCAAACAAGAATAA
GTTGATAATGGAATTTCTTTATAAGAGGCTTTAGCTTAATTAACCTTGTTTTTGGAATAA
AATAAGTTGATAGGATCATCATTCACTTTTATAACTTGCGGAGACTTTGATTTAGGAAAC
TGTTTGAGAAGAGAAGCTCTTTATAAAAAAATAGAAATTCCTTAATACTTAAAAAATTAT
ATAAATATTAAAAAAGTCTTCCCAAAATAATATTATCCTAAACAAAAGAAAGAAGGTGAT
AATAGATTACCTGACATGGTAGGAATGTTGCAAGGATTAAATCTCAAATTAGATGGACAC
CACCATTCAGGAATAGATGATTCAAAAAATATTGCGAAAATCGCTCTCACTTTATTACAA
AAAGGATTTAAATTTAATAAAAATATGAGAGCATTTTCAAATTACTGA


>TTHERM_00585450(gene)
ATGGACTAAAAAAATTAAATTAACAATGATTTTGACTATTTACTGATATTAGATTTCGAA
GCTACTTGCGAAAAAAATGTTAAATTAGAATGTTAAGAAATAATAGAATTTCCTGTTGTT
GTTTTAGATGTTAAAAACTAATAAATATTAGATGTCTTTTTCCATCATTATATAAAGCCT
TCTGTAAATCCTAAACTCACAGCTTTTTGCACAGAATTAACTGGAATCAAACAAGAATAA
GTTGATAATGGAATTTCTTTATAAGAGGCTTTAGCTTAATTAACCTTGTTTTTGGAATAA
AATAAGTTGATAGGATCATCATTCACTTTTATAACTTGCGGAGACTTTGATTTAGGAAAC
TGTTTGAGAAGAGAAGCTCTTTATAAAAAAATAGAAATTCCTTAATACTTAAAAAATTAT
ATAAATATTAAAAAAGTCTTCCCAAAATAATATTATCCTAAACAAAAGAAAGAAGGTGAT
AATAGATTACCTGACATGGTAGGAATGTTGCAAGGATTAAATCTCAAATTAGATGGACAC
CACCATTCAGGAATAGATGATTCAAAAAATATTGCGAAAATCGCTCTCACTTTATTACAA
AAAGGATTTAAATTTAATAAAAATATGAGAGCATTTTCAAATTACTGA


>TTHERM_00585450(protein)
MDQKNQINNDFDYLLILDFEATCEKNVKLECQEIIEFPVVVLDVKNQQILDVFFHHYIKP
SVNPKLTAFCTELTGIKQEQVDNGISLQEALAQLTLFLEQNKLIGSSFTFITCGDFDLGN
CLRREALYKKIEIPQYLKNYINIKKVFPKQYYPKQKKEGDNRLPDMVGMLQGLNLKLDGH
HHSGIDDSKNIAKIALTLLQKGFKFNKNMRAFSNY