Identifiers and Description

Gene Model Identifier

TTHERM_00586540

Standard Name

RRP4 (exosome complex RRP4)

Aliases

PreTt24066 | 81.m00123 | 3726.m00003

Description

RRP4 exosome complex exonuclease RRP4 putative

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_16912.1 9.997093137033517e-262
Description: hypothetical protein (310 aa)
SGD YHR069C 4.001202823045957e-54
Description: RRP4 Exosome non-catalytic core component; involved in 3-5 RNA processing and degradation in both the nucleus and the cytoplasm; predicted to contain RNA binding domains; has similarity to human hRrp4p (EXOSC2)
Oxytricha Contig16332.0.g85 1.999534248571833e-46
Description: Exosome complex exonuclease RRP4 N-terminal region
DictyBase DDB_G0291310 2.999884853455273e-42
Description: DDB_G0291310 on chromosome: 6 position 112763 to 113905
WormBase WBGene00022232 9.99893167504554e-35
Description: locus:exos-2 status:Confirmed UniProt:Q95XD0 protein_id:CCD74150.1
Stentor Coeruleus SteCoe_7026 5.74952226429356e-19
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00586540(coding)
ATGGGCGATTTATTAAAAATTAAAGATTAAATAGACTTCAAAAAATATTTGCATGATGAT
ATGCTTGGTTTAAATATTGTATTGCCAGGTGATGTCATTAAAAAAGAAAAAGGTTTCATG
AATGGACATGGTACTTATGAAGAAAACGGAATTATTTATTCTTCAGTAATAGGAACAGTA
GTATAAACAAATAAGTTGCTTAGTGTGTCACCACTTAAGTCATATTACACTCCTTAAGTA
GGAGATATTGTTGTAGGAAGGGTTATGGAAATAGGAGACAAGAAATGGAAAATAGAAATA
GGATCTAATTAATATGCAAGTCTTCACTTGAATTCAACTTATATTCCTGAACAGAGAATT
AAAACAGATGAAGATGAGTTAAATATGAGATAAATCATGAAAGAAGGAGACTTAGCTTGT
GCAGAAATTCATTCTATTAACAAGGACAAGACAGCAAACTTGCATACTAGAAGTTTAAAA
TACGGCAAGCTTGAAAATGGATTTTTGGTGGAAGTATTTAACAAACTAGTGAAAACTTAA
ACTAACCACTTCAAAAAGTTGTAATGTGGAATCAATATTATATTTTCTCACAATGGTAAA
ATTTGGCTCAACAATATTTCTAGAGAAGGCATTATTAAAGAGTAAAAAGAAGTAGAAAAG
AAATAATATAGCTATGAAGAAAGATAGGCTCTCAGCATAATCTCAAACTTACTTAAATTA
CTTGATCAATAAAATATAAAAATCAGCACTGATTTACTTGATGAGCTTTATAATTATGTG
ATTACAAAGAAAATAGAACCATCAAATATTCTAACATAAGCAGGATCTAAGGAATTAAAG
TAGTATCTGTAATAAAAATTAGAAACATAAATTCCTAAAGAAATTAATAAATTAATGAAA
TAAGGAGACTATTTAGCTTAAGATTATTGA


>TTHERM_00586540(gene)
ATGGGCGATTTATTAAAAATTAAAGATTAAATAGACTTCAAAAAATATTTGCATGATGAT
ATGCTTGGTTTAAATATTGTATTGCCAGGTGATGTCATTAAAAAAGAAAAAGGTTTCATG
AAGTAATTTCAATTCTTTAACATTTGTGTTTGCAATTATTTATTTATTGAATTGATTTTA
ATTATCTTAGTGGACATGGTACTTATGAAGAAAACGGAATTATTTATTCTTCAGTAATAG
GAACAGTAGTATAAACAAATAAGTAAAGCTTTACTTATTCATCAATTCAAATTAGCAATG
TTTTTTATTTCTTAAATAGGTTGCTTAGTGTGTCACCACTTAAGTCATATTACACTCCTT
AAGTAGGAGATATTGTTGTAGGAAGGGTTATGGAAGTAAATAAACGATTTCGTTTATAAT
AGGAATATAAAATTATAATATTTAATAGATAGGAGACAAGAAATGGAAAATAGAAATAGG
ATCTAATTAATATGCAAGTCTTCACTTGAATTCAACTTATATTCCTGAACAGGTTTATTA
TTTCCTTTCAAAAAGCATAGATTGATTTAAAACTTTAACATTTTTATAGAGAATTAAAAC
AGATGAAGATGAGTTAAATATGAGATAAATCATGAAAGAAGGAGACTTAGCTTGTGCAGA
AATTCATTGTAAATAAAATAACTCTAAAATATAAATATTAACATAATCTATATTTCAGCT
ATTAACAAGGACAAGACAGCAAACTTGCATACTAGAAGTTTAAAATACGGCAAGCTTGAA
AATGGATTTTTGGTGGAAGTATTTAACAAACTAGTGAAAACTTAAACTAACCACTTCAAA
AAGTTGTAATGTGGAATCAATATTATATTTTCTCACAATGGTAAAATTTGGCTCAACAAT
ATTTCTAGAGAAGGCATTATTAAAGAGTAAAAAGAAGTAGAAAAGAAATAATATAGCTAT
GAAGAAAGATAGGCTCTCAGCATAATCTCAAACTTACTTAAATTACTTGATCAATAAAAT
ATAAAAATCAGCACTGATTTACTTGATGAGCTTTATAATTATGTGATTACAAAGAAAATA
GAACCATCGTAAATTATTTTATAAATAAACACTTTATTTATATTTTAACTTAAAAAGAAA
TATTCTAACATAAGCAGGATCTAAGGAATTAAAGTAGTATCTGTAATAAAAATTAGAAAC
ATAAATTCCTAAAGAAATTAATAAATTAATGAAATAAGGAGACTATTTAGCTTAAGATTA
TTGA


>TTHERM_00586540(protein)
MGDLLKIKDQIDFKKYLHDDMLGLNIVLPGDVIKKEKGFMNGHGTYEENGIIYSSVIGTV
VQTNKLLSVSPLKSYYTPQVGDIVVGRVMEIGDKKWKIEIGSNQYASLHLNSTYIPEQRI
KTDEDELNMRQIMKEGDLACAEIHSINKDKTANLHTRSLKYGKLENGFLVEVFNKLVKTQ
TNHFKKLQCGINIIFSHNGKIWLNNISREGIIKEQKEVEKKQYSYEERQALSIISNLLKL
LDQQNIKISTDLLDELYNYVITKKIEPSNILTQAGSKELKQYLQQKLETQIPKEINKLMK
QGDYLAQDY