Identifiers and Description

Gene Model Identifier

TTHERM_00586851

Standard Name

RAD3L6 (RADiation sensitive protein family 3-like protein 6)

Aliases

3726.m00753

Description

hypothetical protein; DEAD protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_16927.1 9.997093137033517e-262
Description: hypothetical protein (879 aa)
Oxytricha Contig243.0.g104 1.9991517704232713e-32
Description: Helicase C-terminal domain
SGD YPL008W 5.00094715178354e-25
Description: CHL1 Probable DNA helicase involved in sister-chromatid cohesion and genome integrity; interacts with ECO1 and CTF18; mutants are defective in silencing, rDNA recombination, aging and the heat shock response; FANCJ-like helicase family member
DictyBase DDB_G0286621 5.999207186122604e-25
Description: fncJ on chromosome: 4 position 4729555 to 4732791
WormBase WBGene00001049 2.000620012690291e-23
Description: locus:dog-1 status:Partially_confirmed UniProt:O62217 protein_id:CAB04262.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00586851(coding)
ATGAAAAATATTATAAATTCGCTATGCGAAAAATAAAATCTGCTATTTTAATCACCAACA
GGAACAGGTAAAACACTTGTAACTATTTGTTCTGCTCTTGCATACGCTGAGAAGAATCCT
AATGTTTAGGTATTAGTTTTAACAAGAACTAATGAATAAATAAATGGTTTTATAAAAGAA
ATAAGAAAAATTAATAAATATCCAAAGATAAGCAAGTATTCTATTTTGGCTGGAAGAAAT
TAGTTTTGTTTAAATCTTGATGATTTTAAAAAAGATTTTGAAAAGCAAGGAATAAAAAAA
TCTAAATTTAATAAACATCTTACTAAAGAATGTAATGATAGATGTAAAAGAACTAATTGT
GAAACCCACAAAGCTATGTAATCTCCTGATTTGAGCTTATTTGCATAAAATAAATATGTA
AATATTAATCAAAGAGTATTTTAAGATTAAAGGGAATAACTAGGGTGCACATGTTGCCCA
CATTTCAAAATTTACAAAAAGATTCTAAAAAAGAAGTAGAAAGAAAATTTAAAAATGGAT
ATACATTTTCCATTTGTAAGTTAAGGTTATAATCAACAATATAATTTGCCTGATATTGAA
GACATGAAGGAATTATTCGAACAATAAGAGTTAGGGTGCCCATTTTATTTTAATAAACTA
GCAACACGCTCTGCTAAATTGGTTTTTTCTACATACAACTATCTTATTAAATAGAATATA
TTAGGAAATATTAAAGACCTCTTTGAAGGTGAAGTAGTTGTAATTTTTGATGAAGCTCAT
AATATTTCAGAGTAAGCTGAGCAAGAATAAAGTACTAAAATGCAATAAAAATATTGGGAT
TAATTGGATACTACTCTTCAATAAGTATAAAGAGTTTTTAACAAAAATAATTATTCTAGC
TAAAATCTAAATAATCTTTATCGAAATGTTCAAGATATAATTTGTAAAGATATTTAAGAA
GAAGCTAATTATTTCATGTCTAGTCTCTAAAAAAAAATAGTTGAGGGTGAAAGTACAGAT
ACAGAGAGTGATAAGTCTGATTTAGATTCTTCTAGCCAAGAACAAAATGATAAAGATGAT
GATGATGTGGAAAAAGTCTCTCCTAAATTTAAGCATGTAAAATACATTAAATAGGTATCC
CAGGAGGATTAAAAGCAATCAAAAAGGAAATTTATTTAAAACATCCAGTTTTCCTCTCAA
GATATTTATGATAAAATAAATTTAATAATTTTTAATAATGGTGAATTACCATAAAATTCG
GATGAGAATCTTAAACAAATTTAATAGTACATAAAAGATATTAAATAAAATAAAGATTAT
ACAATTGTTGAAATGGAAAGTACATTTGCATCTTATTAAGATTTAAGAAGAAAAGAAATA
TTGGATTTTTTTAACAATTTTCAGGGTCACTTCTTAAGCATAAAAGAAGATTGTGAGAAC
ATTTAATATATATTTGATGAAAAAAATTAAAAGGATGTTAAACCTTTTTGCTGTCTTTTT
TCAGATAAAGAAATTACAAAATAATTTTAATTATTGAATGTAGTTGACGTTAAACAAGCT
GAAAATTTTATTGATAGGTTAACAAAAATGTTTACCATGCTCTAATATTTAAAAAAAGTG
ATTAGAGTTTACACAGAAAAGGAAAAAAAAGAATCTAAAAGTAAAAGTGATGCTCAACGC
AATATTTTTGTAGCCGAAAATAATTAAATATATGAAGCTAATTAAGATGATTTAAATAAT
TTAAAAAAATTCGGAGAGCAACTTAAGCTGAAATATATATAAAAAATATGGTTCTTTTTC
TATAGACTAATAAAACTGAGAAAGATGTATAATTACTCAGAAGACCCTATTTATTTATCA
AACCATTATATTTCACTTCTTAGAGGAGAATATTCTTTAGTGCCCGTTTTATAAATAGGT
TGTCTATCAGCTTCATATCTTTTTAAAAAAATTTATAAAAAGCTAAAAATAAGTTCTTTA
ATACTGACTTCAGGTACACTAGAACCATTTGAGTTAATATAGAAATCTTTAGATTTAGAA
TTTTAAACATATTCCTCTCCTCATATAATTAATTCGTAGACAAATCTTTTTACTTAATTT
ATTAGCCACTACAATGATTAAGAGATTTCCTTCAGTATGAAAAAACTTGAAAATGAAGAT
AATAAAAATAATATTTTTTATCATTCTTAGTTAGCAATTCACTTTATTACAAATAAATTT
AATGAGTATACTAATCAAGTAAAATAAAAAGGGGGAATGGTTATTTTCTTCAAGAGTTAT
TCAATGCTTTAACAATACTACTTTTTGATTAAAAATTATTAATCTAATGACTTTCGATAC
TTTGTAGAAACAAGAGATGCGAATGAATTTAAAGAAATCTATAGCTAATATAAGTAGCTT
ATTCAAAATAATCGAACTAATTGTGTTTTCTTAGCTGTAAATAGGGGTAAACTCTCTGAA
GGTATTGATTTAAAAGATAATTTATGCAGAGTAGTTATCCTTTTCGGAGTTCCATATCCA
TGCTTTACAGATCCATATGTAGTTTGTAAAAGAACTCATGCAAAGCTTTATTTAAAGGAA
GAACAATGGTATAAAAAAGAGACTGTGAAGGTTGTCAACTAATCTGCAGGAAGATGTATC
CGCTACAAAGATGATTGGGGTTGCATTTTTTTCTTAGACTCTTAATATTACTCAGAAAGC
AATATATATAAACATATATCAAAATGGATTTTAGATGGCCAAAAAGCAAAAGTGAAATAA
ACTGATGAATGGACTTAACATTACTCTGAATTTTTATCAAATAAAGCTTAAGAGTATTTC
TAAAAATAAAATTTTTGA


>TTHERM_00586851(gene)
ATGAAAAATATTATAAATTCGCTATGCGAAAAATAAAATCTGCTATTTTAATCACCAACA
GGAACAGGTAAAACACTTGTAACTATTTGTTCTGCTCTTGCATACGCTGAGAAGAATCCT
AATGTTTAGGTATTAGTTTTAACAAGAACTAATGAATAAATAAATGGTTTTATAAAAGAA
ATAAGAAAAATTAATAAATATCCAAAGATAAGCAAGTATTCTATTTTGGCTGGAAGAAAT
TAGTTTTGTTTAAATCTTGATGATTTTAAAAAAGATTTTGAAAAGCAAGGAATAAAAAAA
TCTAAATTTAATAAACATCTTACTAAAGAATGTAATGATAGATGTAAAAGAACTAATTGT
GAAACCCACAAAGCTATGTAATCTCCTGATTTGAGCTTATTTGCATAAAATAAATATGTA
AATATTAATCAAAGAGTATTTTAAGATTAAAGGGAATAACTAGGGTGCACATGTTGCCCA
CATTTCAAAATTTACAAAAAGATTCTAAAAAAGAAGTAGAAAGAAAATTTAAAAATGGAT
ATACATTTTCCATTTGTAAGTTAAGGTTATAATCAACAATATAATTTGCCTGATATTGAA
GACATGAAGGAATTATTCGAACAATAAGAGTTAGGGTGCCCATTTTATTTTAATAAACTA
GCAACACGCTCTGCTAAATTGGTTTTTTCTACATACAACTATCTTATTAAATAGAATATA
TTAGGAAATATTAAAGACCTCTTTGAAGGTGAAGTAGTTGTAATTTTTGATGAAGCTCAT
AATATTTCAGAGTAAGCTGAGCAAGAATAAAGTACTAAAATGCAATAAAAATATTGGGAT
TAATTGGATACTACTCTTCAATAAGTATAAAGAGTTTTTAACAAAAATAATTATTCTAGC
TAAAATCTAAATAATCTTTATCGAAATGTTCAAGATATAATTTGTAAAGATATTTAAGAA
GAAGCTAATTATTTCATGTCTAGTCTCTAAAAAAAAATAGTTGAGGGTGAAAGTACAGAT
ACAGAGAGTGATAAGTCTGATTTAGATTCTTCTAGCCAAGAACAAAATGATAAAGATGAT
GATGATGTGGAAAAAGTCTCTCCTAAATTTAAGCATGTAAAATACATTAAATAGGTATCC
CAGGAGGATTAAAAGCAATCAAAAAGGAAATTTATTTAAAACATCCAGTTTTCCTCTCAA
GATATTTATGATAAAATAAATTTAATAATTTTTAATAATGGTGAATTACCATAAAATTCG
GATGAGAATCTTAAACAAATTTAATAGTACATAAAAGATATTAAATAAAATAAAGATTAT
ACAATTGTTGAAATGGAAAGTACATTTGCATCTTATTAAGATTTAAGAAGAAAAGAAATA
TTGGATTTTTTTAACAATTTTCAGGGTCACTTCTTAAGCATAAAAGAAGATTGTGAGAAC
ATTTAATATATATTTGATGAAAAAAATTAAAAGGATGTTAAACCTTTTTGCTGTCTTTTT
TCAGATAAAGAAATTACAAAATAATTTTAATTATTGAATGTAGTTGACGTTAAACAAGCT
GAAAATTTTATTGATAGGTTAACAAAAATGTTTACCATGCTCTAATATTTAAAAAAAGTG
ATTAGAGTTTACACAGAAAAGGAAAAAAAAGAATCTAAAAGTAAAAGTGATGCTCAACGC
AATATTTTTGTAGCCGAAAATAATTAAATATATGAAGCTAATTAAGATGATTTAAATAAT
TTAAAAAAATTCGGAGAGCAACTTAAGCTGAAATATATATAAAAAATATGGTTCTTTTTC
TATAGACTAATAAAACTGAGAAAGATGTATAATTACTCAGAAGACCCTATTTATTTATCA
AACCATTATATTTCACTTCTTAGAGGAGAATATTCTTTAGTGCCCGTTTTATAAATAGGT
TGTCTATCAGCTTCATATCTTTTTAAAAAAATTTATAAAAAGCTAAAAATAAGTTCTTTA
ATACTGACTTCAGGTACACTAGAACCATTTGAGTTAATATAGAAATCTTTAGATTTAGAA
TTTTAAACATATTCCTCTCCTCATATAATTAATTCGTAGACAAATCTTTTTACTTAATTT
ATTAGCCACTACAATGATTAAGAGATTTCCTTCAGTATGAAAAAACTTGAAAATGAAGAT
AATAAAAATAATATTTTTTATCATTCTTAGTTAGCAATTCACTTTATTACAAATAAATTT
AATGAGTATACTAATCAAGTAAAATAAAAAGGGGGAATGGTTATTTTCTTCAAGAGTTAT
TCAATGCTTTAACAATACTACTTTTTGATTAAAAATTATTAATCTAATGACTTTCGATAC
TTTGTAGAAACAAGAGATGCGAATGAATTTAAAGAAATCTATAGCTAATATAAGTAGCTT
ATTCAAAATAATCGAACTAATTGTGTTTTCTTAGCTGTAAATAGGGGTAAACTCTCTGAA
GGTATTGATTTAAAAGATAATTTATGCAGAGTAGTTATCCTTTTCGGAGTTCCATATCCA
TGCTTTACAGATCCATATGTAGTTTGTAAAAGAACTCATGCAAAGCTTTATTTAAAGGAA
GAACAATGGTATAAAAAAGAGACTGTGAAGGTTGTCAACTAATCTGCAGGAAGATGTATC
CGCTACAAAGATGATTGGGGTTGCATTTTTTTCTTAGACTCTTAATATTACTCAGAAAGC
AATATATATAAACATATATCAAAATGGATTTTAGATGGCCAAAAAGCAAAAGTGAAATAA
ACTGATGAATGGACTTAACATTACTCTGAATTTTTATCAAATAAAGCTTAAGAGTATTTC
TAAAAATAAAATTTTTGA


>TTHERM_00586851(protein)
MKNIINSLCEKQNLLFQSPTGTGKTLVTICSALAYAEKNPNVQVLVLTRTNEQINGFIKE
IRKINKYPKISKYSILAGRNQFCLNLDDFKKDFEKQGIKKSKFNKHLTKECNDRCKRTNC
ETHKAMQSPDLSLFAQNKYVNINQRVFQDQREQLGCTCCPHFKIYKKILKKKQKENLKMD
IHFPFVSQGYNQQYNLPDIEDMKELFEQQELGCPFYFNKLATRSAKLVFSTYNYLIKQNI
LGNIKDLFEGEVVVIFDEAHNISEQAEQEQSTKMQQKYWDQLDTTLQQVQRVFNKNNYSS
QNLNNLYRNVQDIICKDIQEEANYFMSSLQKKIVEGESTDTESDKSDLDSSSQEQNDKDD
DDVEKVSPKFKHVKYIKQVSQEDQKQSKRKFIQNIQFSSQDIYDKINLIIFNNGELPQNS
DENLKQIQQYIKDIKQNKDYTIVEMESTFASYQDLRRKEILDFFNNFQGHFLSIKEDCEN
IQYIFDEKNQKDVKPFCCLFSDKEITKQFQLLNVVDVKQAENFIDRLTKMFTMLQYLKKV
IRVYTEKEKKESKSKSDAQRNIFVAENNQIYEANQDDLNNLKKFGEQLKLKYIQKIWFFF
YRLIKLRKMYNYSEDPIYLSNHYISLLRGEYSLVPVLQIGCLSASYLFKKIYKKLKISSL
ILTSGTLEPFELIQKSLDLEFQTYSSPHIINSQTNLFTQFISHYNDQEISFSMKKLENED
NKNNIFYHSQLAIHFITNKFNEYTNQVKQKGGMVIFFKSYSMLQQYYFLIKNYQSNDFRY
FVETRDANEFKEIYSQYKQLIQNNRTNCVFLAVNRGKLSEGIDLKDNLCRVVILFGVPYP
CFTDPYVVCKRTHAKLYLKEEQWYKKETVKVVNQSAGRCIRYKDDWGCIFFLDSQYYSES
NIYKHISKWILDGQKAKVKQTDEWTQHYSEFLSNKAQEYFQKQNF