Identifiers and Description

Gene Model Identifier

TTHERM_00592750

Standard Name

DRS2 (Aspartyl-tRNA synthetase 2)

Aliases

PreTt25028 | 82.m00118 | 3835.m00528

Description

DRS2 cytoplasmic aspartyl-tRNA synthetase; tRNA synthetases class II

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

  • glutathionylspermidine synthase activity (IEA) | GO:0008885
  • L-histidine:2-oxoglutarate aminotransferase activity (IEA) | GO:0008110

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_18334.1 5.001841681745041e-174
Description: aspartyl-tRNA synthetase (631 aa)
Oxytricha Contig8290.0.g58 1.0001155149984988e-113
Description: tRNA synthetases class II (D, K and N)
DictyBase DDB_G0272236 9.997751616309157e-110
Description: aspS1 on chromosome: 2 position 1722204 to 1724012
SGD YLL018C 1.000434858898539e-105
Description: DPS1 Aspartyl-tRNA synthetase, primarily cytoplasmic; homodimeric enzyme that catalyzes the specific aspartylation of tRNA(Asp); class II aminoacyl tRNA synthetase; binding to its own mRNA may confer autoregulation
WormBase WBGene00001094 2.9996910481190226e-100
Description: locus:dars-1 Aspartate--tRNA ligase, cytoplasmic status:Confirmed UniProt:Q03577 protein_id:CAA79536.1
Stentor Coeruleus SteCoe_27181 3.817497188671175e-54
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00592750(coding)
ATGGCTGAATGTTTATAAGAATCTGCTTAAAAAATATCAGAAGAAATATAAGAAAATAAA
TAGAATTTTGAAGAAAATTATTCTAATAATTAAAATTCAATAAAAATAAAATTAAAATAA
AATAAGTTAATAAAAATAAAAAATGAAGCTTTATAAAATGAAGAAAAGTGGGTTTAAGAG
CTCAATGACGATTCTCTTAAGGAAAATTATGGAGACTATTAACTTGTCTAGAGCTTATAA
TAAACAAACAAGAAATGGATTTAAGAAAGAATATCTTGA


>TTHERM_00592750(gene)
ATGGCTGAATGTTTATAAGAATCTGCTTAAAAAATATCAGAAGAAATATAAGAAAATAAA
TAGAATTTTGAAGAAAATTATTCTAATAATTAAAATTCAATAAAAATAAAATTAAAATAA
AATAAGTTAATAAAAATAAAAAATGAAGCTTTATAAAATGAAGAAAAGTGGGTTTAAGAG
CTCAATGACGATTCTCTTAAGGAAAATTATGGAGACTATTAACTTGTCTAGAGCTTATAA
TAAACAAACAAGAAATGGATTTAAGTAACTCTACTCTTCATAATTATTTTTCATGATACA
ATTGATTTTTTTAGCAATAAAAAACTTTTAAAAATAAATGAAAATTTTTTAATAAACAAA
ACATATAGATTAAGGATATTGATGATTCTTTTTTAGGAAAGAATATCTTGATTAGAGGGA
GGTTGCATAATCTAAGGATTATTGGAAATTGTGCGTTTTTAATTGTAAGACAACAATCTT
AAAATATTTAAGTTGTTGCACAAAAGCAAGCTGATATAACTTCTAAAACTATGATTAAAT
GGATTAAAAAGATACACCTTGAGTCAATAATAGATATTCATGGAATAGTTTAAAAACCTA
ATATTCCTATCAATTGTGCTTCATCTTAATATGAAATTTGTTTGAAAAAAATATTTGTAG
TATCTAGGAGTAGTTCTCTTAATTATGGAGTAGCAGATATTTAAAGAATAAAAAAAAAAG
TTTAAAAGAAATTAGTGATGAAAATGAAGAAATAGATTTAGAAGATAGAAAAGCAATAAA
TAATTCGTTTTTATTTAATACCATCAATAAAGTTATTGATTTAAGAACCTCTGCTTAGCA
AGCTATATTCAGGCTGAAGTCAAGTATTTGCCAGATGTTTAGAGAAAATTTATTGCTTTA
AGGGTTTATAGAAATTCATACTCCTAAAATAATTTAGAGCTTTAAAAAAGAATATTCTGA
TAGCTTTTCTCTTGATTATTTTGGTATAGATGCTTAACTAAGTAATTTTCCAAAGTTTTA
TTCATAAATGGCTATTTAATCTGATTTTGAAAGAGTCTTTGAAATAGGTCCTATTTATAG
GAAACTTCATGGTAGAACTCATCACACTCTATGTGAATTTATTGGAATGAATCTTGAAAT
GGAAATCAAAGAAAGCTACTAAGAGGTTATTGATATCGTAACAGACTTACTTTTTAGTAT
ATTTTTAAGTTTAGAAATGATGTTTTAATAAGAGCTACAAATTGTTAAAGAATATTTTCC
TTCTTAAACGCTTAAAATAAAAAAACCTGTTCTGTAAATTTCATTTTAGGAAGCTTGTAG
TTTATTAGGTGAAGTCTAAAATTAGATGGATTATTTAGATAATATAAATTAAGTAAAATT
AAGTAAAATAATAAGTTAAAAGTATGATACAGATTTCTATATAATCACTCAATTTCCATC
TATTTCAAGTAATTTTATGGATATAGTTTGTGATGAAGAGCCTAATTATACATATTCTTA
CAAATTCTTTTTAAGAAACGGAGAAATAGCATCTGGATCACAAAGAAATCATGATCCTTT
ATCTTTAGAAAAAAGAGCTTTACAATATGGAATTGATATTAATTCAATAAAAAAATATAT
TGATGTAATTTCTTATGGTGCTTATCCGCATGGAGGCTGCTGTATTGGTTTGGAAAGATT
AATTTTGTATTACTTAGATTTATAGAACATAAGAAAAGCATCTTTATTTTCTCGAGATAG
CAAAACAATAAATCCATGAAAAAGTCAAACAAACAACAAAAGAAATTAAATTAATTTATA
TATTATTTTTTTTTTTGAATATTATAAATATGCTATTTTTATCTTTGGTAAATTCACCTT
AATAATTCGTATATAAGAATATATATTATATTTTCATATATGTATTAATTAAAGATTTAT
AATTATTTTTTGGTTATTAATATATTTTTATTAGTGGCTCAAAATTAATGAGTAATTAGA
GTATTTAGAAAAAAAATTTTAATTTAATAAAATGTTATGAAATATTAAAGATGTAGTATT
AGACTGAGCAAAATTAATAGATAATAAATATGTGA


>TTHERM_00592750(protein)
MAECLQESAQKISEEIQENKQNFEENYSNNQNSIKIKLKQNKLIKIKNEALQNEEKWVQE
LNDDSLKENYGDYQLVQSLQQTNKKWIQERIS