Identifiers and Description

Gene Model Identifier

TTHERM_00592800

Standard Name

IMA6 (IMportin Alpha 6)

Aliases

PreTt25033 | 82.m00123 | 3835.m00533

Description

IMA6 importin subunit alpha; Armadillo/beta-catenin-like repeat family protein; Karyopherin/Importin alpha family member

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_07536.1 9.997093137033517e-262
Description: armadillo/beta-catenin repeat family protein (562 aa)
DictyBase DDB_G0272318 9.996907204735647e-62
Description: DDB_G0272318 on chromosome: 2 position 1278811 to 1280712
Oxytricha Contig20249.0.g40 4.998711177326993e-55
Description: Armadillo/beta-catenin-like repeat
SGD YNL189W 9.995951036711152e-55
Description: SRP1 Karyopherin alpha homolog, forms a dimer with karyopherin beta Kap95p to mediate import of nuclear proteins, binds the nuclear localization signal of the substrate during import; may also play a role in regulation of protein degradation
WormBase WBGene00002074 2.0008536325002377e-42
Description: locus:ima-3 Importin subunit alpha-3 status:Confirmed UniProt:Q19969 protein_id:CCD70435.1
Stentor Coeruleus SteCoe_15530 6.47023492564546e-26
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:18676955: Malone CD, Falkowska KA, Li AY, Galanti SE, Kanuru RC, LaMont EG, Mazzarella KC, Micev AJ, Osman MM, Piotrowski NK, Suszko JW, Timm AC, Xu MM, Liu L, Chalker DL (2008) Nucleus-specific importin alpha proteins and nucleoporins regulate protein import and nuclear division in the binucleate Tetrahymena thermophila. Eukaryotic cell 7(9):1487-99

Sequences

>TTHERM_00592800(coding)
ATGGATACTCAAATATTAGGATAAGTTAACTTATGCAAGGAAAAATTAACTTAGGAAGGA
TCTCCTTTAGAGACAATTATAGAATTGAGGAAAATGACTTCAAAGGAAGTCAGTCCTCCT
CTTTAAGAGATAATATAGTCAAATGTTTGCACTTAGCTAATAGCTATAATGGACAACACC
ACAAGCAATGAAATTATCTTGGAATCACTTTGGATTCTCACTAATGTGTGTTCAGGCAGT
AGCAGTTAGACATAATATGTTATAAATATTGGCGGTATCGCTACTTTCTTAAAGTACGTC
TAACATGAAAGCGAAGATATTATGGCTCAAGCTCTTTGGGGTTTAGGAAATATTGCTGGA
GATAGTAGCAGCAGCAGAGATTAAGTGCTCAAATAAGATGCTGTGACAATTGTTCTCAAA
TAATTAGAAAGAAAAGACATTAAAATAGTCAACTAAAGAACTATTGTTTGGGTTATTTCT
AATTTTTGTAGAGGAAAGCCTTAGCCAAAATACGAAATAGTGCGTCCTTGTGTATTTTAT
TTGGGTAAAGCTTTAGAGAAATACAAAAATGATCCAGAGATTGTTGCTGATTCTCTATGG
GGAATAAATTATCTCAGTGAAACAGAGCTAGCAATTGATGATTTAATAAATTATGGAATT
TTATAAAATATATGTTAACACTTCTTGAATTTTAATTCAACCTCAACACTAACACCTGCA
GTCAGAATTATAGGTAATGTGGCAACTTCTAGAGATAATTATGTTGATATTCTCCTTTAA
TAGAATATTCTCCAACCGTTGATACAGCTATTTGTTCATGATAAAAAAGCATACAGAAAA
GAATCTCTTTGGACTGTTTCAAATATTATGGCTGGAACTTCTACCTAGGTTTAAAAGGTT
TTAGAGCAACCAAATTTCTATCAGAATTTAATAAATAATGTGGGTTAATAGCTAGATATT
AGAAAAGAAATGCTTTATGTCATGTCAAATGGTTTAGGTCACTCTGCAGCCTGTTCTTTT
TTCTTAAAAAATGGCATCTTATAAGTGTTCTTTGAACAATTTGAAGAAGGAGATTCTAAA
ATGAAAATGGTTATTTTAGAAGGGCTTCAGCTACTCTTGAAATATGTTAATAAGAATAAG
AAAGTTTACCCCGTTTTAAACGGAAAGCTCCAATATCTTAAGAGTATTGCTACAGAAACT
ATTTATTCAAATATGGCTGATAAGTTAAAAGCTGTTTATAAACTCTTGAGAAATTATGAA
AAAATAAATCCTCCTGTAGATGCAATAAATAGCTAACTTGAGAACTTGAAAATAGACGAA
TAACAATAAAGATAAACTGAAAGCTCTTACGAAACTATTGACAATGAAGAAGATGACGAA
GAAGACATGGATGAAGAGTTTGAAGATTGCGAAGATATTGACGAAGAAGAAGAGCAATAA
AATGATGAAATATAAAATAATTTGAATAAGCAAAAAGCACAAGGAGCAAATGCAAAAGGT
AATTAAGAGTATGAAAGCATTTAAAGTAATGATAAAGACTTTTTGGGAGCAGCTGCAGGT
CCAGCAGCTCCTCCAAATTTAGATTAGCTCGAATATTAATATACAGACGAATAATAATAG
TATATGTAGGCATAGGCTGGTGCTGCACCAGGTCCATGA


>TTHERM_00592800(gene)
ATGGATACTCAAATATTAGGATAAGTTAACTTATGCAAGGAAAAATTAACTTAGGAAGGA
TCTCCTTTAGAGACAATTATAGAATTGAGGAAAATGACTTCAAAGGAAGTCAGTCCTCCT
CTTTAAGAGATAATATAGTCAAATGTTTGCACTTAGCTAATAGCTATAATGGACAACACC
ACAAGCAATGAAATTATCTTGGAATCACTTTGGATTCTCACTAATGTGTGTTCAGGCAGT
AGCAGTTAGACATAATATGTTATAAATATTGGCGGTATCGCTACTTTCTTAAAGTACGTC
TAACATGAAAGCGAAGATATTATGGCTCAAGCTCTTTGGGGTTTAGGTAATGAACAAAAT
AGATTTAATCAAGATAGATATTTATAAATTATTTTTTTTTTGTATGAATTTATTATTAAT
TTTTGGTATTAATTATTTATTATTTTAGGAAATATTGCTGGAGATAGTAGCAGCAGCAGA
GATTAAGTGCTCAAATAAGATGCTGTGACAATTGTTCTCAAATAATTAGAAAGAAAAGAC
ATTAAAATAGTCAACTAAAGAACTATTGTTTGGGTTATTTCTAATTTTTGTAGAGGAAAG
CCTTAGCCAAAATACGAAATAGTGCGTCCTTGTGTATTTTATTTGGGTAAAGCTTTAGAG
AAATACAAAAATGATCCAGAGATTGTTGCTGATTCTCTATGGGGAATAAATTATCTCAGT
GAAACAGAGCTAGCAATTGATGATTTAATAAATTATGGAATTTTATAAAATATATGTTAA
CACTTCTTGAATTTTAATTCAACCTCAACACTAACACCTGCAGTCAGAATTATAGGTAAT
GTGGCAACTTCTAGAGATAATTATGTTGATATTCTCCTTTAATAGAATATTCTCCAACCG
TTGATACAGCTATTTGTTCATGATAAAAAAGCATACAGAAAAGAATCTCTTTGGACTGTT
TCAAATATTATGGCTGGAACTTCTACCTAGGTTTAAAAGGTTTTAGAGCAACCAAATTTC
TATCAGAATTTAATAAATAATGTGGGTTAATAGCTAGATATTAGAAAAGAAATGCTTTAT
GTCATGTCAAATGGTTTAGGTCACTCTGCAGCCTGTTCTTTTTTCTTAAAAAATGGCATC
TTATAAGTGTTCTTTGAACAATTTGAAGAAGGAGATTCTAAAATGAAAATGGTTATTTTA
GAAGGGCTTCAGCTACTCTTGAAATATGTTAATAAGAATAAGAAAGTTTACCCCGTTTTA
AACGGAAAGCTCCAATATCTTAAGAGTATTGCTACAGAAACTATTTATTCAAATATGGCT
GATAAGTTAAAAGCTGTTTATAAACTCTTGAGAAATTATGAAAAAATAAATCCTCCTGTA
GATGCAATAAATAGCTAACTTGAGAACTTGAAAATAGACGAATAACAATAAAGATAAACT
GAAAGCTCTTACGAAACTATTGACAATGAAGAAGATGACGAAGAAGACATGGATGAAGAG
TTTGAAGATTGCGAAGATATTGACGAAGAAGAAGAGCAATAAAATGATGAAATATAAAAT
AATTTGAATAAGCAAAAAGCACAAGGAGCAAATGCAAAAGGTAATTAAGAGTATGAAAGC
ATTTAAAGTAATGATAAAGACTTTTTGGGAGCAGCTGCAGGTCCAGCAGCTCCTCCAAAT
TTAGATTAGCTCGAATATTAATATACAGACGAATAATAATAGTATATGTAGGCATAGGCT
GGTGCTGCACCAGGTCCATGA


>TTHERM_00592800(protein)
MDTQILGQVNLCKEKLTQEGSPLETIIELRKMTSKEVSPPLQEIIQSNVCTQLIAIMDNT
TSNEIILESLWILTNVCSGSSSQTQYVINIGGIATFLKYVQHESEDIMAQALWGLGNIAG
DSSSSRDQVLKQDAVTIVLKQLERKDIKIVNQRTIVWVISNFCRGKPQPKYEIVRPCVFY
LGKALEKYKNDPEIVADSLWGINYLSETELAIDDLINYGILQNICQHFLNFNSTSTLTPA
VRIIGNVATSRDNYVDILLQQNILQPLIQLFVHDKKAYRKESLWTVSNIMAGTSTQVQKV
LEQPNFYQNLINNVGQQLDIRKEMLYVMSNGLGHSAACSFFLKNGILQVFFEQFEEGDSK
MKMVILEGLQLLLKYVNKNKKVYPVLNGKLQYLKSIATETIYSNMADKLKAVYKLLRNYE
KINPPVDAINSQLENLKIDEQQQRQTESSYETIDNEEDDEEDMDEEFEDCEDIDEEEEQQ
NDEIQNNLNKQKAQGANAKGNQEYESIQSNDKDFLGAAAGPAAPPNLDQLEYQYTDEQQQ
YMQAQAGAAPGP