Identifiers and Description

Gene Model Identifier

TTHERM_00600230

Standard Name

MRNC07 (Membrane Occupation and Recognition Nexus protein C-terminal)

Aliases

PreTt22086 | 83.m00155 | 3685.m00047

Description

MORN motif protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_14890.1 2.0002546692351096e-156
Description: hypothetical protein (381 aa)
Oxytricha Contig9596.0.g47 0.0000000000000030004923591262316
Description: MORN repeat
DictyBase DDB_G0349488 0.00000030014504373857585
Description: DDB_G0349488 on chromosome: 2 position 6912714 to 6914186

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00600230(coding)
ATGAAGAAACTTTTCAACATGTTTTCATCTAGGCCTCACTATAATATAGAGGACGTCAAG
ACTCCATCTAACCAAAATTATAAGGTCTTTGATGCTGATTGCTCTGCTGTTCCTATTTTT
GAAAACTAAATGAAAGATATATCCTACATAAATGCAGATAGAGGTAGCACATTAGAAATA
AATAGAGTTAATGAAGAAGATACTAGCTCATATCAAGCTGCTCCTATTCAAGTTATTTCT
CCTTAAGCACCACAAAAAATTATAAATCAAAAAATTAAAACTGTGCGTATACGCTTAATC
TAAGAGAAGCAAAGCAAATCCTCTATTTCAAACAGTCAAGAAAAATACAAAGCTGAAGTA
AAAGCAAAGGATTAATGCTTTAAATAAATTGCAAAGACAATATATATTTTCTACACTGCA
GAGGACTTGCTTGCTTAATTAGCTACCTGCTCTTACTTCAATGGATTTAAACCTTTGAAC
TACAATCACATCAAATAATGCCTATTTCCTTCTAATGATTGCAATGACCAAAACGCCTAA
AAATAAAAAAAGAAAAGCTCTATTTAAGTACTCAAGTATTATATAACTTAAACAGATGAA
GGAGAATATCATGGCTAAATGAATAAAAATAAAGTACCTGAAGGCAACTCAATACTATTC
TACAAAAATGGTAATTAATACATTGGTGAAATGAAAAATAGATTTAGAAACGGATAAGGT
TCTATGTTCTATCCAGACGGTAGCTCATATACCGGCGGATGGGTTCTAGATGCTAAAGAA
GGATAAGGTAAAGAAACAGAAACAAAAGGAGAAGTATTTACTGGAAACTTCATAAACAAT
TGTAGAAGCGGAAAAGGATAATTAATTTATAAAAACGGCTATGTTCTTGAATCAAACTGG
ATTAATGGCTATTAAGATGGTCTCTCCACATTAAGTGTTGGTAAATAATAAATTCAAGTC
CTATTCTGCATGGGCTAAATAGTGAAAATAAACTCAACTCCTATATAGGATTTGTAAAAC
GTTTCTAATGAAAATCAAAATATAACGAATTTAATTTAAATAAATTTCTGCAGAGACTAA
GTATAAGTCTTTAAAAACCAACCTATTCCTTCTTACCTCACTGCAAGATTTTGA


>TTHERM_00600230(gene)
ATGAAGAAACTTTTCAACATGTTTTCATCTAGGCCTCACTATAATATAGAGGACGTCAAG
ACTCCATCTAACCAAAATTATAAGGTCTTTGATGCTGATTGCTCTGCTGTTCCTATTTTT
GAAAACTAAATGAAAGATATATCCTACATAAATGCAGATAGAGGTAGCACATTAGAAATA
AATAGAGTTAATGAAGAAGATACTAGCTCATATCAAGCTGCTCCTATTCAAGTTATTTCT
CCTTAAGCACCACAAAAAATTATAAATCAAAAAATTAAAACTGTGCGTATACGCTTAATC
TAAGAGAAGCAAAGCAAATCCTCTATTTCAAACAGTCAAGAAAAATACAAAGCTGAAGTA
AAAGCAAAGGATTAATGCTTTAAATAAATTGCAAAGACAATATATATTTTCTACACTGCA
GAGGACTTGCTTGCTTAATTAGCTACCTGCTCTTACTTCAATGGATTTAAACCTTTGAAC
TACAATCACATCAAATAATGCCTATTTCCTTCTAATGATTGCAATGACCAAAACGCCTAA
AAATAAAAAAAGAAAAGCTCTATTTAAGTACTCAAGTATTATATAACTTAAACAGATGAA
GGAGAATATCATGGCTAAATGAATAAAAATAAAGTACCTGAAGGCAACTCAATACTATTC
TACAAAAATGGTAATTAATACATTGGTGAAATGAAAAATAGATTTAGAAACGGATAAGGT
TCTATGTTCTATCCAGACGGTAGCTCATATACCGGCGGATGGGTTCTAGATGCTAAAGAA
GGATAAGGTAAAGAAACAGAAACAAAAGGAGAAGTATTTACTGGAAACTTCATAAACAAT
TGTAGAAGCGGAAAAGGATAATTAATTTATAAAAACGGCTATGTTCTTGAATCAAACTGG
ATTAATGGCTATTAAGATGGTCTCTCCACATTAAGTGTTGGTAAATAATAAATTCAAGTC
CTATTCTGCATGGGCTAAATAGTGAAAATAAACTCAACTCCTATATAGGATTTGTAAAAC
GTTTCTAATGAAAATCAAAATATAACGAATTTAATTTAAATAAATTTCTGCAGAGACTAA
GTATAAGTCTTTAAAAACCAACCTATTCCTTCTTACCTCACTGCAAGATTTTGA


>TTHERM_00600230(protein)
MKKLFNMFSSRPHYNIEDVKTPSNQNYKVFDADCSAVPIFENQMKDISYINADRGSTLEI
NRVNEEDTSSYQAAPIQVISPQAPQKIINQKIKTVRIRLIQEKQSKSSISNSQEKYKAEV
KAKDQCFKQIAKTIYIFYTAEDLLAQLATCSYFNGFKPLNYNHIKQCLFPSNDCNDQNAQ
KQKKKSSIQVLKYYITQTDEGEYHGQMNKNKVPEGNSILFYKNGNQYIGEMKNRFRNGQG
SMFYPDGSSYTGGWVLDAKEGQGKETETKGEVFTGNFINNCRSGKGQLIYKNGYVLESNW
INGYQDGLSTLSVGKQQIQVLFCMGQIVKINSTPIQDLQNVSNENQNITNLIQINFCRDQ
VQVFKNQPIPSYLTARF