Identifiers and Description

Gene Model Identifier

TTHERM_00600840

Standard Name

Anqa14

Aliases

PreTt22147 | 83.m00216 | 3685.m00108 | TCXL1

Description

Tesmin/TSO1-like CXC domain containing protein. Homolog of Lin54. Tetrahymena contains at least 14 Lin54-like genes (Anqa1-14) (Nabeel-Shah et al. 2021). Anqa14 is also called TCXL1.

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF03638 ) Tesmin/TSO1-like CXC domain
  • ( PF05033 ) Pre-SET motif
  • ( TIGR01918 ) selenoprotein B, glycine/betaine/sarcosine/D-proline reductase family

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_19109.1 1.0003292389192957e-45
Description: hypothetical protein (127 aa)
Oxytricha Contig7608.0.g75 3.9989916100764785e-24
Description: Tesmin/TSO1-like CXC domain
WormBase WBGene00003037 9.995317835403734e-19
Description: locus:lin-54 Protein lin-54 status:Partially_confirmed UniProt:Q95QD7 protein_id:CAB05229.1
DictyBase DDB_G0281519 4.0002685161515803e-16
Description: lin54 on chromosome: 3 position 4464773 to 4467683

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:34086947: Nabeel-Shah S, Garg J, Saettone A, Ashraf K, Lee H, Wahab S, Ahmed N, Fine J, Derynck J, Pu S, Ponce M, Marcon E, Zhang Z, Greenblatt JF, Pearlman RE, Lambert JP, Fillingham J (2021) Functional characterization of RebL1 highlights the evolutionary conservation of oncogenic activities of the RBBP4/7 orthologue in Tetrahymena thermophila. Nucleic acids research ( ):
  2. Ref:29417875: Zhang J, Yan G, Tian M, Ma Y, Xiong J, Miao W (2018) A DP-like transcription factor protein interacts with E2fl1 to regulate meiosis in Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 17(5):634-642

Sequences

>TTHERM_00600840(coding)
ATGTAAAAGGGTAATAGCAACACAAACTATATGTTAGACTCAAATAGGAGCAATATTCAA
GAAGAGCTAAAAAACTTCTACAGCCAAATGGAGATTTCTCCTAATCATAGCTTTAATAAC
TTAGATACTCACAATTTTGAATATTGTGCATCAAAAAATTAAATGGGATTTAGTGAAGGT
GAAGGTACAAACGAAACAAAAGTAAAGAATATCCTAGCTCACTACTTAGAAGAAAACGAT
GAAGAAATTAGCAAGACAGAAGATCACGCAACTGAGTCAGTAAACCAAAGCTGCTGTGAC
CTTAAAAAATAGCCTGATTATAATTTTCACAGTTTTTCGGATTAAAATTATTAGTATGGT
AAGGAATCGCCATCTTCTGATTTTCGCTTATTTTAGCATGAAGATGATATAGCAAATGAT
CTTTCATCTTCAGAGAAGCTTGACTTTTTCGATATCAATGAATAGACTATATATAAGTAG
AAGTTGAGTTATACAACTCAAGTTGAAGACTTTATAATGAACTGTACACCAAATCCATTT
TGCTTTGAAGCTTAAAAAGCTGTAGAAAAGATATTCTTAAATAAAAGGATTGAAGAAATG
AAGAAAAAAAGACTACTAACAAAGAAGCTTATGAACAAATATCAAAACAAAAAAGAAAAG
GACATATTTTTGTAGCAAAGCTATAACTAGCTTTATGAAGATGTAAAAGATAACAAAGAA
GAGCCTAACATTAGTCCACGCAAAATATTTTAAAAGGAATTTATATAATAAGAAGAATAA
ATAGAAGATCTCAACAAAAACAGTAATAGTAATAATAATCCACAATAAATTCTGCCAAAT
TTCGATTAGTCTTCGCTAAGCATAAACGCTAATCAAGCAATAGTAATAAATAATAATATG
TAAAAAAAATAATAACCAAATAACAAGTTGCAAAGTATTGATAGTAGTAAAGAGGGGGAA
ATTTTGAGAGTTTCAAAAACTCCTTGCAAATGCAGAAAATCTCTTTGTCTTAAACTTTAC
TGCGAATGCTTTGCAAGAGGTGAAATTTGTGGACATGCTTGCGTTTGCTTAGAATGTAAA
AATTCTAAAAATCACTTAGAATTAAGAAATGAAGCCATTAAGGTTATTGAAGCCAAAAAT
CCATCAGCTTTTTTGTTTTCTAACATTTAAGCAACAACAAATCTTAATAATTAAGATAAA
AACCTTACAAATATGTAACTTGAATAATAAGACATGGCTATGGATATAAGAAGAGGTTGT
AATTGCAAAAAATCTAAATGCAAAAAGAAATATTGTGAGTGCTATATGATAGGGAAAAGA
TGTTCTTCACTTTGCCAATGTTTAAATTGCTCTAATAATAATTCTCACTCACACACCATA
TCTTCTTACAGCTAGTCTCCTATTTAGCACAATGATTTATTAGACTCGAACTAAGAGTCA
AAAAACAATTCAATAATTAAATTAAAACCAGTTCTAGCAAAGGAATAGAAAAAATTATTT
GATATTGTAAATCAAGAATATTAGAATATCCAACAAGATGACTAGTCGTTATTGCATACT
CTTAAAGATTCTAATAAATAATATAAATTACAAGGAAAAAGCTAATACCAAAAATAGGAA
TCACCTTAATTAATAAAATAAAAAAATTTTTAGAATTAAATACTTCCAAAAAAAACAGAA
ATATTTGCTTTTAAAGATACAATTCGTCATACAGATAATTAAAAAGATAATACGACATAT
TCTTAATTTGAAGCTAAATAAACCACAGATTATAGCCAATTGCATTCAAGTAAAGAGAAT
AAGATTAATTTAAAAGCTACTAAAAAGATTATAAAAACAAAAAAAGTTAATCACACAAAT
TATTATTGA


>TTHERM_00600840(gene)
ATGTAAAAGGGTAATAGCAACACAAACTATATGTTAGACTCAAATAGGAGCAATATTCAA
GAAGAGCTAAAAAACTTCTACAGCCAAATGGAGATTTCTCCTAATCATAGCTTTAATAAC
TTAGATACTCACAATTTTGAGTAAGATGATTAGATTCATTGCTTGCTATTTTTTCTCTTT
TTCATAGATTTTAATTTCTTTGTTTTTATTATCCTTTAATTAGATATTGTGCATCAAAAA
ATTAAATGGGATTTAGTGAAGGTGAAGGTACAAACGAAACAAAAGTAAAGAATATCCTAG
CTCACTACTTAGAAGAAAACGATGAAGAAATTAGCAAGACAGAAGATCAGTAAATAAAAT
TAATGCTTTTTAGAAATATTTTATTCATAAATTTGTTTTCTTTAATTGATAGCGCAACTG
AGTCAGTAAACCAAAGCTGCTGTGACCTTAAAAAATAGCCTGATTATAATTTTCACAGTT
TTTCGGATTAAAATTATTAGTATGGTAAGGAATCGCCATCTTCTGATTTTCGCTTATTTT
AGCATGAAGATGATATAGCAAATGATCTTTCATCTTCAGAGAAGCTTGACTTTTTCGATA
TCAATGAATAGACTATATATAAGTAGAAGTTGAGTTATACAACTCAAGTTGAAGACTTTA
TAATGAACTGTACACCAAATCCATTTTGCTTTGAAGCTTAAAAAGCTGTAGAAAAGATAT
TCTTAAATAAAAGGATTGAAGAAATGAAGAAAAAAAGACTACTAACAAAGAAGCTTATGA
ACAAATATCAAAACAAAAAAGAAAAGGACATATTTTTGTAGCAAAGCTATAACTAGCTTT
ATGAAGATGTAAAAGATAACAAAGAAGAGCCTAACATTAGTCCACGCAAAATATTTTAAA
AGGAATTTATATAATAAGAAGAATAAATAGAAGATCTCAACAAAAACAGTAATAGTAATA
ATAATCCACAATAAATTCTGCCAAATTTCGATTAGTCTTCGCTAAGCATAAACGCTAATC
AAGCAATAGTAATAAATAATAATATGTAAAAAAAATAATAACCAAATAACAAGTTGCAAA
GTATTGATAGTAGTAAAGAGGGGGAAATTTTGAGAGTTTCAAAAACTCCTTGCAAATGCA
GAAAATCTCTTTGTCTTAAACTTTACTGCGAATGCTTTGCAAGAGGTGAAATTTGTGGAC
ATGCTTGCGTTTGCTTAGAATGTAAAAATTCTAAAAATCACTTAGAATTAAGAAATGAAG
CCATTAAGGTTATTGAAGCCAAAAATCCATCAGCTTTTTTGTTTTCTAACATTTAAGCAA
CAACAAATCTTAATAATTAAGATAAAAACCTTACAAATATGTAACTTGAATAATAAGACA
TGGCTATGGATATAAGAAGAGGTTGTAATTGCAAAAAATCTAAATGCAAAAAGAAATATT
GTGAGTGCTATATGATAGGGAAAAGATGTTCTTCACTTTGCCAATGTTTAAATTGCTCTA
ATAATAATTCTCACTCACACACCATATCTTCTTACAGCTAGTCTCCTATTTAGCACAATG
ATTTATTAGACTCGAACTAAGAGTCAAAAAACAATTCAATAATTAAATTAAAACCAGTTC
TAGCAAAGGAATAGAAAAAATTATTTGATATTGTAAATCAAGAATATTAGAATATCCAAC
AAGATGACTAGTCGTTATTGCATACTCTTAAAGATTCTAATAAATAATATAAATTACAAG
GAAAAAGCTAATACCAAAAATAGGAATCACCTTAATTAATAAAATAAAAAAATTTTTAGA
ATTAAATACTTCCAAAAAAAACAGAAATATTTGCTTTTAAAGATACAATTCGTCATACAG
ATAATTAAAAAGATAATACGACATATTCTTAATTTGAAGCTAAATAAACCACAGATTATA
GCCAATTGCATTCAAGTAAAGAGAATAAGATTAATTTAAAAGCTACTAAAAAGATTATAA
AAACAAAAAAAGTTAATCACACAAATTATTATTGA


>TTHERM_00600840(protein)
MQKGNSNTNYMLDSNRSNIQEELKNFYSQMEISPNHSFNNLDTHNFEYCASKNQMGFSEG
EGTNETKVKNILAHYLEENDEEISKTEDHATESVNQSCCDLKKQPDYNFHSFSDQNYQYG
KESPSSDFRLFQHEDDIANDLSSSEKLDFFDINEQTIYKQKLSYTTQVEDFIMNCTPNPF
CFEAQKAVEKIFLNKRIEEMKKKRLLTKKLMNKYQNKKEKDIFLQQSYNQLYEDVKDNKE
EPNISPRKIFQKEFIQQEEQIEDLNKNSNSNNNPQQILPNFDQSSLSINANQAIVINNNM
QKKQQPNNKLQSIDSSKEGEILRVSKTPCKCRKSLCLKLYCECFARGEICGHACVCLECK
NSKNHLELRNEAIKVIEAKNPSAFLFSNIQATTNLNNQDKNLTNMQLEQQDMAMDIRRGC
NCKKSKCKKKYCECYMIGKRCSSLCQCLNCSNNNSHSHTISSYSQSPIQHNDLLDSNQES
KNNSIIKLKPVLAKEQKKLFDIVNQEYQNIQQDDQSLLHTLKDSNKQYKLQGKSQYQKQE
SPQLIKQKNFQNQILPKKTEIFAFKDTIRHTDNQKDNTTYSQFEAKQTTDYSQLHSSKEN
KINLKATKKIIKTKKVNHTNYY