Identifiers and Description

Gene Model Identifier

TTHERM_00614790

Standard Name

ATG18 (AuTophaGy 18)

Aliases

PreTt19127 | 85.m00120 | 3725.m00013

Description

ATG18 WD repeat protein putative; Autophagy protein; involved in programmed nuclear degradation

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_21121.1 9.997093137033517e-262
Description: hypothetical protein (454 aa)
DictyBase DDB_G0282581 8.002082816694397e-20
Description: wdr45l on chromosome: 3 position 5969861 to 5971133
Oxytricha Contig857.1.g19 2.0004286606204839e-16
Description: WD domain, G-beta repeat
SGD YGR223C 0.0000000020002373268528243
Description: HSV2 Phosphatidylinositol 3,5-bisphosphate-binding protein, plays a role in micronucleophagy; predicted to fold as a seven-bladed beta-propeller; displays punctate cytoplasmic localization
WormBase WBGene00012641 0.000009002574193719714
Description: locus:epg-6 status:Confirmed UniProt:Q86MP3 protein_id:CAD60426.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22366125: Liu ML, Yao MC (2012) Role of ATG8 and autophagy in programmed nuclear degradation in Tetrahymena thermophila. Eukaryotic cell 11(4):494-506

Sequences

>TTHERM_00614790(coding)
ATGCAAAAGTAAAATATAGTTTCAGGCTTTGAAGTCATAGATAACTTTTCGGATGATGAA
ACACATCCTAATAAATAGCTGAACTAGCCTAGATAATAAAAATCTGATATAAAAAGCTCT
AAATAGCAATCAAAATAAGATGAAAACATTACAAAATAAGAGTAGAAAAATAAAATAGAA
TAGTAATAGCAATTCATAGAAAATTCATAAAACTACGAATAGACAGATGAAACAGATGAC
ACTGAATTTCTGCATAAAAATATTCCAAAGATATATGCAATTACATTTTCGTAAACAGGA
AAAACTGTAGCAATAGGAACTGAAGAAGGGTTGAGAATATAATCATCTGAATCATTAAAA
GTTGGAATGTTAAATAAAAAATATATTATGGAAAAAGAAAAAAACTCTTTTTATTGTGGT
ATTAAGCTTGTTTCTTTAATGTTTGATACTTATATTTGTGCTTTAGTCACTGATAATAAG
AACAAATAATATCCTGATTCTAAAGTTTATATTTGGGATTAAAAAAATAGTCAAATAATA
GGTTAGTATGAATTCTATTCGCCAATTCTATAAATTTGTTATATGAGAGAATTCCTTTTA
GTTGCAAGCGAGTAACGTTTAGTCTTGTATGACATAGTGCAAAAAAAACCACTAAAATAT
ATTTTAGATATATCTACTCCTTAAAAATTTGTAGCTAGCTAACGTTATGACACATTCACC
TTTTGTTATTTAACAAAAAATAAAGGAATGATTATAGCAACAAATGTTTGGTATGACAAC
CCAGTTTAAATTGACTTTAATTAGGAAATAGGCGTTTCTACACCATAATCTTTAGAATAA
AGAGAATTTGATATTTCAAATATGGTTTTAAGTCATGATGGAAGTCTATTAGCTGCCTGC
GAAAAAGGTGGTAATATTATCAAAATTTTTGATACAGAAAAAGGTAAACTCAAATGTACT
CTTTACAGAGGTAAATATCCTAAAATAATTACAGACATGTAATTTAAGAAGGACTTAACT
GCTTTTGGATTAATAAGTACTTATGAATAGAAAAGTGAAGATGAAGGCACTATACATATA
TATGATATATCTATGATAAGTTAATTTAATAAGGAGCCAAATAAAATACCTTTTACTAGG
TTTTAAAATATCAGAAGCTAATAATTCAATTTCGATATTCTCAAAAAATACTCTTATGCA
TCAAAAGATACAAAATTCTAAGGGCCTTTAATTTAATTTGATCCTTAAGGTGGTAATTCA
TTTACTATTTATTCAGAATCTGATTATACACTAAGTTAGGAATATAATTTAACTTCTGAT
GAGCCTAAAAAAAGACTTACAGATAATTAAAAGCAAGATGGATGGATAGATCCTATTTAA
GATGGGTGA


>TTHERM_00614790(gene)
ATGCAAAAGTAAAATATAGTTTCAGGCTTTGAAGTCATAGATAACTTTTCGGATGATGAA
ACACATCCTAATAAATAGCTGAACTAGCCTAGATAATAAAAATCTGATATAAAAAGCTCT
AAATAGCAATCAAAATAAGATGAAAACATTACAAAATAAGAGTAGAAAAATAAAATAGAA
TAGTAATAGCAATTCATAGAAAATTCATAAAACTACGAATAGACAGATGAAACAGATGAC
ACTGAATTTCTGCATAAAAATATTCCAAAGATATATGCAATTACATTTTCGTAAACAGGA
AAAACTGTAGCAATAGGAACTGAAGAAGGGTTGAGAATATAATCATCTGAATCATTAAAA
GTTGGAATGTTAAATAAAAAATATATTATGGAAAAAGAAAAAAACTCTTTTTATTGTGGT
ATTAAGCTTGTTTCTTTAATGTTTGATACTTATATTTGTGCTTTAGTCACTGATAATAAG
AACAAATAATATCCTGATTCTAAAGTTTATATTTGGGATTAAAAAAATAGTCAAATAATA
GGTTAGTATGAATTCTATTCGCCAATTCTATAAATTTGTTATATGAGAGAATTCCTTTTA
GTTGCAAGCGAGTAACGTTTAGTCTTGTATGACATAGTGCAAAAAAAACCACTAAAATAT
ATTTTAGATATATCTACTCCTTAAAAATTTGTAGCTAGCTAACGTTATGACACATTCACC
TTTTGTTATTTAACAAAAAATAAAGGTAGAATTATATTATTAAAAATTATATTTAAAATG
ATAATATTTTCTTTAAAATAAAAGGAATGATTATAGCAACAAATGTTTGGTATGACAACC
CAGTTTAAATTGACTTTAATTAGGAAATAGGCGTTTCTACACCATAATCTTTAGAATAAA
GAGAATTTGATATTTCAAATATGGTTTTAAGTCATGATGGAAGTCTATTAGCTGCCTGCG
AAAAAGGTGGTAATATTATCAAAATTTTTGATACAGAAAAAGGTAAACTCAAATGTACTC
TTTACAGAGGTAAATATCCTAAAATAATTACAGACATGTAATTTAAGAAGGACTTAACTG
CTTTTGGATTAATAAGTACTTATGAATAGAAAAGTGAAGATGAAGGCACTATACATATAT
ATGATATATCTATGATAAGTTAATTTAATAAGGAGCCAAATAAAATACCTTTTACTAGGT
TTTAAAATATCAGAAGCTAATAATTCAATTTCGATATTCTCAAAAAATACTCTTATGCAT
CAAAAGATACAAAATTCTAAGGGCCTTTAATTTAATTTGATCCTTAAGGTGGTAATTCAT
TTACTATTTATTCAGAATCTGATTATACACTAAGTTAGGAATATAATTTAACTTCTGATG
AGCCTAAAAAAAGACTTACAGATAATTAAAAGCAAGATGGATGGATAGATCCTATTTAAG
ATGGGTGA


>TTHERM_00614790(protein)
MQKQNIVSGFEVIDNFSDDETHPNKQLNQPRQQKSDIKSSKQQSKQDENITKQEQKNKIE
QQQQFIENSQNYEQTDETDDTEFLHKNIPKIYAITFSQTGKTVAIGTEEGLRIQSSESLK
VGMLNKKYIMEKEKNSFYCGIKLVSLMFDTYICALVTDNKNKQYPDSKVYIWDQKNSQII
GQYEFYSPILQICYMREFLLVASEQRLVLYDIVQKKPLKYILDISTPQKFVASQRYDTFT
FCYLTKNKGMIIATNVWYDNPVQIDFNQEIGVSTPQSLEQREFDISNMVLSHDGSLLAAC
EKGGNIIKIFDTEKGKLKCTLYRGKYPKIITDMQFKKDLTAFGLISTYEQKSEDEGTIHI
YDISMISQFNKEPNKIPFTRFQNIRSQQFNFDILKKYSYASKDTKFQGPLIQFDPQGGNS
FTIYSESDYTLSQEYNLTSDEPKKRLTDNQKQDGWIDPIQDG