Identifiers and Description

Gene Model Identifier

TTHERM_00616050

Standard Name

DRS1 (Aspartyl-tRNA synthetase 1)

Aliases

PreTt19154 | 85.m00147 | 3725.m00038

Description

DRS1 aspartyl-tRNA synthetase protein; aspartyl-tRNA synthetase family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

  • glutathionylspermidine synthase activity (IEA) | GO:0008885
  • L-histidine:2-oxoglutarate aminotransferase activity (IEA) | GO:0008110

Biological Process

Domains

  • ( PF00152 ) tRNA synthetases class II (D,
  • ( PF00587 ) tRNA synthetase class II core
  • ( PF01336 ) OB-fold nucleic acid binding domain
  • ( TIGR00457 ) asparaginyl-tRNA synthetase
  • ( TIGR00458 ) aspartyl-tRNA synthetase
  • ( TIGR00459 ) aspartyl-tRNA synthetase
  • ( TIGR00462 ) lysyl-tRNA synthetase-like protein GenX
  • ( TIGR00499 ) lysyl-tRNA synthetase

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Stentor Coeruleus SteCoe_27181 0
Description: None
Tetrahymena borealis EI9_18334.1 9.997093137033517e-262
Description: aspartyl-tRNA synthetase (631 aa)
Oxytricha Contig8290.0.g58 9.997093137033517e-262
Description: tRNA synthetases class II (D, K and N)
SGD YLL018C 9.00303245425055e-177
Description: DPS1 Aspartyl-tRNA synthetase, primarily cytoplasmic; homodimeric enzyme that catalyzes the specific aspartylation of tRNA(Asp); class II aminoacyl tRNA synthetase; binding to its own mRNA may confer autoregulation
DictyBase DDB_G0272236 3.999622461503957e-161
Description: aspS1 on chromosome: 2 position 1722204 to 1724012
WormBase WBGene00001094 6.002643599093603e-161
Description: locus:dars-1 Aspartate--tRNA ligase, cytoplasmic status:Confirmed UniProt:Q03577 protein_id:CAA79536.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00616050(coding)
ATGGCTGATAAAGTTGAAACCCCCGTTGTTGAAAAACAAGAAGAAACTGTCCCTGTTGAA
GGAGCTGCTAAGGAAGGTGGTGAAAATGCTTCTAAGAAAGCTCAAAAGAAGCTTGAAAAG
GAACAAGAAAAGGAAAGAAAGAGATTAGAAAGAGAAGCCGCCTAATTGAAGGAATAGGAG
GAAAATTGGCTTAAGGAACTCAAGGAAGATACTCTTAAGGAAAACTACGGAGATTATATC
CTTGTTCAAAGTCAAGAAAAGACTGACAGAAAGTGGATTTAGGTTTTGAGTATTGATGAA
TCAATGGTCGGTTAAACCGTCTTGATCAGAGCAAGACTCCAAAATTCTAGAGTTAAGGGT
AATGTCGGTTTCTTAGTTTTGAGATAACAATTTTCTACCATCCAAGCTATGATCTCTAAG
AACGACGTCACTGTTTCTAAGACCATGGTTAAATGGGTTGGTAAGGTTCCTTGTGAATCT
ATCGTTGATGTTTACGGTGTTGTCTCTAAGCCTGAAACTGAAATTAAGAGTACTTCATGC
AAACTTGAATTGATTGTCAACAAGGTTTATGTTGTCTCTCGTTCAAGAGCTCAACTTCCT
TTCCAATTAGAAGATGCTGCTAGATAATAAAAGAAGGAAGAACAATTAGCTGAATACAAT
AACAATGAAGGTGATATTGAAGAATCTAAGGATAATTAAGCCAGTGTCTCCATTAAAACT
CGTTTAGATAACAGAATTATTGATTTAAGAACTCCTGCCAAGCAAGCTATTTTCAGATTA
CAATCTGGTATCTGCCAATTATTCCGTGAATACTTACTTTCATAAGATTTCGTTGAAATT
CACACTCCTAAGCTTATTGGTGGTTCTTCTGAAGGTGGTGCTAACATCTTCAAGTTGAAG
TATTTCGATAAGGATGCTTGTCTTGCTTAATCTCCTTAACTCTACAAGTAAATGTGTATC
TAATCTGACTTCGAAAGAGTCTTCGAAATAGGTCCCGTTTTCAGAGCTGAAAAATCATTC
ACCCATCGTCACATGTGTGAATTCACTGGTTTGGATATTGAAATGTCCATTAAAGAAAAC
TACCATGAGCTTCTTGATCTTATGGGTGATTTATTCGTCCACATCTTCAAGGGCTTAGAA
ACCAAATACAGCAAGGAAATCGAAGCTATTTAATAATAATTCCCCTTCGAACCTTTCAAA
ATTAAAACCCCTGTTGTTAAACTCACTTTCGAAGAAGGTTGCAAACTCTTAAAAGAAGCT
GGTATTGAATAAAACCCCTTAGAAGATTTAGATACTGTTACTGAAAAGAAGCTTGGTGAC
ATCGTCCGTGAAAAGTATGATACTGATTTCTATATGCTCCATAGATATCCTATCTCTGCT
AGACCTTTCTACACCATGCTTTGCCACGATGATCCTAACTACACTCTTTCTTACGATTTC
TTCATGAGAGGTTAAGAAATCACCTCAGGTGCCTAAAGAAATCACGACCCCGTTTCTCTC
GCTAAGCGTGCTGCTGAATGTGGTATCAATGTAGAAACTATTAAAGATTATATTGAATCT
ATGGCTTTCGGTGCTTATCCTCATGGTGGTTGTGGTATTGGTCTTGAAAGAGTTGTTTTC
CTCTACTGCGACCTTTACGATATTAGAAACGGTTGCTTATTCCCCAGAGATCCTAAAAGA
ATTGCTCCTTGA


>TTHERM_00616050(gene)
ATGGCTGATAAAGTTGAAACCCCCGTTGTTGAAAAACAAGAAGAAACTGTCCCTGTTGAA
GGAGCTGCTAAGGAAGGTGGTGAAAATGCTTCTAAGAAAGCTCAAAAGAAGCTTGAAAAG
GAACAAGAAAAGGAAAGAAAGAGATTAGAAAGAGAAGCCGCCTAATTGAAGGAATAGGAG
GAAAATTGGCTTAAGGAACTCAAGGAAGATACTCTTAAGGAAAACTACGGAGATTATATC
CTTGTTCAAAGTCAAGAAAAGACTGACAGAAAGTGGATTTAGGTATTTACTCATTCCTTA
TTACTTTATTTCATATTTTTAAAAGCTCATTTTCAACAACAAAAGTTCAAGTTTTTGTAT
CTTCTTTTGTAGCGCCACAAGCATAAACATAAAAAAGAGAAATACAATCAAATGAGTAAT
AAAAAATAGAAATGCATCAAGAAATTTTAGAAACTAATCTATAAATGCAAACATTTTATC
ATTTTATTAATAACTTTTATTTCTATAATGAATAGGTTTTGAGTATTGATGAATCAATGG
TCGGTTAAACCGTCTTGATCAGAGCAAGACTCCAAAATTCTAGAGTTAAGGGTAATGTCG
GTTTCTTAGTTTTGAGATAACAATTTTCTACCATCCAAGCTATGATCTCTAAGAACGACG
TCACTGTTTCTAAGACCATGGTTAAATGGGTTGGTAAGGTTCCTTGTGAATCTATCGTTG
ATGTTTACGGTGTTGTCTCTAAGCCTGAAACTGAAATTAAGAGTACTTCATGCAAACTTG
AATTGATTGTCAACAAGGTTTATGTTGTCTCTCGTTCAAGAGCTCAACTTCCTTTCCAAT
TAGAAGATGCTGCTAGATAATAAAAGAAGGAAGAACAATTAGCTGAATACAATAACAATG
AAGGTGATATTGAAGAATCTAAGGATAATTAAGCCAGTGTCTCCATTAAAACTCGTTTAG
ATAACAGAATTATTGATTTAAGAACTCCTGCCAAGCAAGCTATTTTCAGATTACAATCTG
GTATCTGCCAATTATTCCGTGAATACTTACTTTCATAAGATTTCGTTGAAATTCACACTC
CTAAGCTTATTGGTGGTTCTTCTGAAGGTGGTGCTAACATCTTCAAGTTGAAGTATTTCG
ATAAGGATGCTTGTCTTGCTTAATCTCCTTAACTCTACAAGTAAATGTGTATCTAATCTG
ACTTCGAAAGAGTCTTCGAAATAGGTCCCGTTTTCAGAGCTGAAAAATCATTCACCCATC
GTCACATGTGTGAATTCACTGGTTTGGATATTGAAATGTCCATTAAAGAAAACTACCATG
AGCTTCTTGATCTTATGGGTGATTTATTCGTCCACATCTTCAAGGGCTTAGAAACCAAAT
ACAGCAAGGAAATCGAAGCTATTTAATAATAATTCCCCTTCGAACCTTTCAAAATTAAAA
CCCCTGTTGTTAAACTCACTTTCGAAGAAGGTTGCAAACTCTTAAAAGAAGCTGGTATTG
AATAAAACCCCTTAGAAGATTTAGATACTGTTACTGAAAAGAAGCTTGGTGACATCGTCC
GTGAAAAGTATGATACTGATTTCTATATGCTCCATAGATATCCTATCTCTGCTAGACCTT
TCTACACCATGCTTTGCCACGATGATCCTAACTACACTCTTTCTTACGATTTCTTCATGA
GAGGTTAAGAAATCACCTCAGGTGCCTAAAGAAATCACGACCCCGTTTCTCTCGCTAAGC
GTGCTGCTGAATGTGGTATCAATGTAGAAACTATTAAAGATTATATTGAATCTATGGCTT
TCGGTGCTTATCCTCATGGTGGTTGTGGTATTGGTCTTGAAAGAGTTGTTTTCCTCTACT
GCGACCTTTACGATATTAGAAACGGTTGCTTATTCCCCAGAGATCCTAAAAGAATTGCTC
CTTGA


>TTHERM_00616050(protein)
MADKVETPVVEKQEETVPVEGAAKEGGENASKKAQKKLEKEQEKERKRLEREAAQLKEQE
ENWLKELKEDTLKENYGDYILVQSQEKTDRKWIQVLSIDESMVGQTVLIRARLQNSRVKG
NVGFLVLRQQFSTIQAMISKNDVTVSKTMVKWVGKVPCESIVDVYGVVSKPETEIKSTSC
KLELIVNKVYVVSRSRAQLPFQLEDAARQQKKEEQLAEYNNNEGDIEESKDNQASVSIKT
RLDNRIIDLRTPAKQAIFRLQSGICQLFREYLLSQDFVEIHTPKLIGGSSEGGANIFKLK
YFDKDACLAQSPQLYKQMCIQSDFERVFEIGPVFRAEKSFTHRHMCEFTGLDIEMSIKEN
YHELLDLMGDLFVHIFKGLETKYSKEIEAIQQQFPFEPFKIKTPVVKLTFEEGCKLLKEA
GIEQNPLEDLDTVTEKKLGDIVREKYDTDFYMLHRYPISARPFYTMLCHDDPNYTLSYDF
FMRGQEITSGAQRNHDPVSLAKRAAECGINVETIKDYIESMAFGAYPHGGCGIGLERVVF
LYCDLYDIRNGCLFPRDPKRIAP