Identifiers and Description

Gene Model Identifier

TTHERM_00621610

Standard Name

THD2 (Tetrahymena Histone Deacetylase 2)

Aliases

PreTt05158 | 86.m00190

Description

THD2 histone deacetylase family protein; Histone deacetylase family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_03031.1 9.997093137033517e-262
Description: hypothetical protein (1599 aa)
Stentor Coeruleus SteCoe_8125 8.074506789675094e-73
Description: None
Oxytricha Contig12864.0.g7 0.00010003404299092957
Description: hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:18178773: Smith JJ, Torigoe SE, Maxson J, Fish LC, Wiley EA (2008) A class II histone deacetylase acts on newly synthesized histones in Tetrahymena. Eukaryotic cell 7(3):471-82

Sequences

>TTHERM_00621610(coding)
ATGTAATAACTTATTTTTCTGTTAGCTACAATCTACTAAATATTAAGAACTACATAGGCA
GGTACAATTACTCCAACAACGCAACCACCTCCGATTTATAATACATTGGCTAATGCGGGA
GTTAGAGCTGACTACACTTTTTCTTTCATTCCACAAACATTTTTACCTGCAGGAGGAAAC
TTATAAATTATATTTCCTTCTCAATATAGTGCTACATAGGCTTTTTAGATAAATAATTTA
GTGTGCAGTGTTACTTGTTAAGCTAGCGGATTAACTCTAACTTTCACATTTCCTTATGAT
CTTGCAGCAGGAATAGCCCAAACTGTTACTGTTTAGCAAGTTTTAAATCCTTCCACTAAA
GGTGGAGTAGGAAGTTTTATACTCCAAACATTATAAGGATAGAATATCGTAGATTAGAAT
AAAATTTTTGGAATTATTGGAATAGCTGATATCTCAACAAATCTAATTTCTGCTAACATT
TAGGTTAATCCTTCAGGTAGTGATCTAGCTGGAGACTACACTTCATATTAGCTCACCTTT
TAAACAGCTAGTAACATACCTGCAGGAAGTTATTTTATCCTATAGATCCCAACAGATTTT
ACCTTAGAAGACTATCCTACATGCATATCACCAAGTTTAAATGGTTACTTTATAGCTGGT
CAGCTTATATGCACTTTATAAAGTAATAATTAGGTTAGAATAGATGGAGTAGTAGGAGTT
CTCACCTAAGGTATCAATTATGTCTTATAAATTTCAATGCAAAATCCTCCATACACTATT
AATCCTAACACAGCTAGTAGTAACTATGTCTTCTCTTTCTAAATTTACAAACAAGGAACT
CAAATATTATTTGAAAGTATCTCTGGCATTTAGGGTCCTGCAATCAATGCTGCTGGATTA
AATAATATCTCTTTAACTCCTACAGATTAATTAAACTTAAATAACAGATATATCTATGCC
GAATACAAGCTAAACTTTACACCAACTCTGGCGCTTGAAAATGGAAATTGTATAGTAATA
TCATTCCCTGCTTATTTTTAGGTATTAGTAAGTTAGTAATTAATGTACTTGTAGGAAAAT
ATGTATTAATTGCATTATATAAATTATGGACTTGATAATTTATCAGAAAATAATAAAGTT
TAAATCTCAGTCAGTTCAAATTCTATTATCATTTCGAACTTTGCTACACAGCAGTTCATT
TAAGAAATATCAGTTATTATCATGACAAGAAACCCAGATGCAGCTGGAACAGCTACTCCA
TTGAAGATATACATATACCAAGATACTACCTAGTCTACTTTAATAGCATAAGATGTGAAT
TCTGCTACTGCTAATATAGATCCTTATACATCATGTGACCATTCAACTGATTAGATTTTA
GCAAGTATCAACTACTATCTATGGAATAATGCTTGGCCTAAGGCAACTTAAACTCCAGTT
GTAATTCCTTCAATTTAATTTGAGTTTAAACCTTTGAAAACTATTCCTATTGGAGGGTTA
ATCAAAATAGCAATTCCTAAAGAATTCACCTTTAATCCTGCATTTCCTACAACTGCGACT
GACTGTGGTATTTATTATGGATATTCTTAGTTTACCATGACTGCAGGAAATACCCCTTAA
TTTAATAACATATATCCTTCATAAAGATAAAGATCTACTCTCTTTTAAACTTATCAGCCT
GTTGGAACTGCTGGTTCTAATTCTTTTGCATGCTAAACTTCAATTACAGGAAATATAATG
ACAATATCTGGCATTCAGAATACACTTTTTGGGAACCAGGGACTCATTCATATATTGGTA
TTAAAAAATTGGGTTATGACTCCAGCAAGAAATGCAACTTACTTTTTTGCCTTAACGTCT
TATGACAGTGACAAATATACAATCTTAGAGTCATGGAAAGATGCATTTTAAATAAACCCA
AAAGATCTTACAACAACTCCAGTAGTCAATCTGATAAATAATTACGTTTCTAGTGTAGCT
ACTATCTCAAAATCTATATTAGATATTTAATTAACAACAGACATAACTATCCCTAGTGGC
TAACCAATATATAAATCAACTGATACTTAAGGATTTATTTAATTAGATTTTAGGTAATTA
TCAGGTGGTGATGCATGGTAGCTTGGACTTGGTCTTAATGTACCCAGTGGGACATAAATA
CCATGTAGAGGTATTTAAGGAATCATACCCATTTAAGGATCATCAATTATTTGTACTTAT
GTATAGGCATCATACACTGCTTTAACCACTACTACATTTTCTTAGATCTTCATAAAAAAT
TTTGTACAAATTCCAGCAAACACTTTAGTTAGAATTCATATTCCTAACCTTCTTAATCCT
TAAGGAGGTGGAACTACTTCTGATTTATCAATAAGACTTGTTTCAAACACAAATAATGTT
TATTAATATTTAGCTTAAAAATCGATTTTAATTACAGATAAACCTATTGGTACTTTTGTT
GTTTAAAATGTATTGAATCTCAGCTATTCAACTAATTATGTGGGATAAACATTCAATTTA
GGTTTTAATACAAAAACCTCACCCTCTGCAGGAGATTTACTCCTTATTTAGCTACCAACG
TTCTCAAACGGTTTCATAGTTCAAGACTAAACTATCTCATGCTCAGTAAACTCTATCAAT
ATGTATTGCATTCCATACTATTAAGCTGATATGATCTTAATTATGATTTCTTAAAATTTT
GCATCACCATAATAATCAATTTTGATATCAAATATAAACTGGCCTCAATATCAAAGTAAC
TTCGTTGCAACTTTTTCAACTCTCGATGTATATTGGACATCTTCGACAGGAGTTACAAAT
AAGGCTGAAAGAAATAACTAATTAATTAACAACCTTCCAAACTAATTTTCTAATGCATCG
ATTGTTATCCCTAAAAAAGGAATTCAATATGTAGATTGCTCTTACCAGTTTAGTTTCACT
GGTAATGCTGATATTCCAGCCTTGAGCTTGATATAAGTTATATTCCCCAATAATTACAAC
CTGTTAGGATCTACCCCACTGCCAACAGTGACATACTCAGGGTTGACTAGCTATAGTTCT
TCACAACAACTATCTATTTAAATAACAATTTAAATGATTACAATTTCAAATAATTAATAT
CTGCCAGCAGGTTCTACATTTACAGTAACAGTTTCAGGAGTTAAGAATCCTTCAACTATG
CCTGCTAATGGTCTATCTACTGGATGGGGAATTCAAGTAGTATAGTACGATGCTGTAAAT
GATATCAGTAATTTAGTTATGCAATAACTAAACTTTTACAGCTTCGCTTTTGATCCAGTT
TTCACACCTGGGACAATTGTTTTCAATTCAATTACAGCTTTTCCACTCAATGCTGACGAA
ACTGCAACTTATACTATTCAGTTCACTCCATATACTAACATACCTATTTAGGGTGTCATC
TAAATTACTTTTCCTTAAAATAATTTTAAATCTCTCCCCTCTCCTCCAAACTGTAGTATG
GGAGGAGCAGTTACAACTTTTAGTAGTTGTACTCTTAGTGGCTCTACTTTCTCAATTGTG
ATTTAAGATTAGTATAATTCTGGTAGTGGAAGTATCACTTTATCCATAACTAATATAAAA
AACCCAGATTAAGGTACTTCAGATGGCTTCATAATAGAAACAACTTACGACGGTCAGACT
TTAGATATTACAGATTAAACCACTTTGAGTAGTAGAACAATAACTACAGTCTAAAGAGCT
CCTGAAATTACTGTAAACTCTATTACCTTTAGTCCATAAAATATAAGCGAAAGAAGTACA
TACACCTTCTCATTTATTACAAGTGATATCATCACTTCTTAAATGTAAATTCTATTCTAG
TTCCCATCAGACTATGATAAGCTATTAGGAAAAAACGTTAAGTGTATTATAGTCTCTGGT
ATATTAGGTAATTTTTATAGTTGTTATGTGTAAAATGGCGGAGTTTATTTATAGAATTTT
GATTCTTATCAACCAAGTAGCTCAAATCCTATAGTTGTTCAGATATTTGGTGTAACAAAC
CCTAATATAGCTTATACTAATACTGGTTAGTTCTCGATATCATTGCTATATAAAGGGGAT
AACAAATTCATCAATTCATAATCTTAGGCAGGATAATTATAAATGTACGGAAATCCAGGA
TGGTTATCTGTTTAGACTGTAACAGCTAGTTAATTTAATGTGAGGTACACTGCTAGTTAT
TAATTTTCTTTTACTCTAAGTAAGAATGTTCCAAAGATTTTATCATAAGGAGCAATATTT
ATAGATTTTCCTCCTTAATTTGATTAAGTCTCAGACGGAAGAGGCTCTTGTACAACTACA
ACAGCTTCTTTCGCTTAGGTTATAGATTGTTACACCATTCAAAATCGTTACAATGTAACA
GGTAATACTCAAGATTTCTCTGGTTAGCTTTAGGTATCAATAGCGTCGGTTCTAAATCCT
ACTTTCTAAGGAATTACTGATAACTTTTATGTAAGTTCATTTGATGGCATAAACCAAATT
ATTATTGATAGAAGCTACATAAATTTAGATCCATTTTCATTTAGCTACGTTTATCCTGGT
CCACTGATTCACGTAAATAATGATTAAGGCATCTCACTCTACCCTGGTACATAAACTGTT
GATCTATATATTACACTAGATTTCCCTTCATTACTTGAGTTAAGTGTAAAGCCAAATATC
TTACCAGGTTTCAAAGTAATCCCATTCGACATTCCTATTCATCTAGGTTAGACATCCATC
CCTTTCAGAATATCCTGCCCATAATAAATATTTTCTGGTTCTTATACACTCTAATGGGTA
ACACTAGGAGATAATGTGCCTCCCATCTACACACCAATATAAACTTCTTAAATTACTATC
CTCAATCCTACAATTTAAACTGTGCTCATGAACTCTATCTTAGATATTCCTTATGGAGGA
ACTTCTTTAGACACAATACTTTCTGTGACTTATGCATCTGATATTTATTTTGAAGTCCAT
ATGAATTTAGCCTCTTAGTATCCAGGAATTTCATTAAGTACTTAAATGCTAAATTTCACC
AAAGGAATAAACTAGCTCAGTTTTAGAGTTATTTCTACTCCTACAAATAATACTAGTTCA
TCTGTTTCAAGAGGTTCTATAGTTTTCTCATTATTGGGAATAGATTCAACTATATTTTAA
CTACAATATACTTAAATGTACTTCAATTTAATAGCGGCTGATAACATAGCACCTCAAATT
ATTTAGCTTCAGACAGTTAATATATTAAAAAATAGTGTTTAAATTAACGTTATGACTAAT
GAACCAACTGTAGTTTACTATATGTGTAGTTTAAATGGAACATCATATCCAAGCTTCTCT
TAAGTTTTTAATAAAACTGCTCCTCCTGCCAATACTACTTAAAGCTAATATGGATAATTA
GTCTTAAATTAAGCTAATGCAAACTTTTACTTTAACATAACAAACCTCACTGCCCAAACT
CCTTATATCATCCATCTATTTTTCTAAGATAGAGGAAATAATGTTGCAAATAAGACTCTA
ACTTTTGTCACAAGCAATCGATATAATGCCGCAACATTTAGTCTGAGATTCTAAGTCCTT
TAACTATCAGCTACTGAAATCAAGAGCGTGCTTATTAATTTATCGAATATTTTAACTATT
GATTTGAATACCTTGTACATCTAGAAATATTATTTTAATAATACCTCCTCAAGTACTAGC
TCAAGTAGAATTCTGTAAAGCACACAATTAGCTGATTAAATAAACCAAATTTAAGAAACT
ACAGATAATCAAGGTAATTAAAAAAGATAAAAGGCTAATAGAATATTAGATGTTTCGACT
TCAATTTATACTTTACTGAACATCTAAATATCTTCAAATAGACTCGTAGAGTATTATCCT
TCGCCATTAACTTTAGCTAATTCTTTGAACAATAAAACTGTATTGCTGAAAGCTGCAATG
CCCACTTATGATAGCTCGTATTTAGTAATCCCAAACACATTTGTATCCTACTATCCTAAT
TTTATTTAGCCTCCTTAATTTTTGTCTAATGACTGGTCTACTGCTAATTTCACAGTCGTC
TTAGACTAACCAGGATTTGTTTATGTGACTGGAGAGTTATATGTCTCAAATACCTAGCCC
TCTCCTTATCCTGATTAAATTTATTGGGGTTATGACCATACAAACATTAAAGCACCTAGC
GGATATGTAGAAGTAAGCTAAGGATATACTTAATTTAACTTAACTCTACGTAACCTTAAA
CCAAATTCAAAGTATTTTGCTTACATAATTGGAGGAAGTGTCCAGCCTGGATACCCAGAT
TTAATGGACGCATCCAAAATAGTAAGAATTTAATTTACAACACTTCCTTCACCTTCAGAT
TTAGAACTAGATATAAATACTGGAACCAAATTAGAATTTAGCACTAAATTTCTAGTGCTA
CTATTTTTAATTATTTAAGTATTCATATGA


>TTHERM_00621610(gene)
ATGTAATAACTTATTTTTCTGTTAGCTACAATCTACTAAATATTAAGAACTACATAGGCA
GGTACAATTACTCCAACAACGCAACCACCTCCGATTTATAATACATTGGCTAATGCGGGA
GTTAGAGCTGACTACACTTTTTCTTTCATTCCACAAACATTTTTACCTGCAGGAGGAAAC
TTATAAATTATATTTCCTTCTCAATATAGTGCTACATAGGCTTTTTAGATAAATAATTTA
GTGTGCAGTGTTACTTGTTAAGCTAGCGGATTAACTCTAACTTTCACATTTCCTTATGAT
CTTGCAGCAGGAATAGGTATCCAATTTTTAATTTATATTTCCACATAAAATAATAACCAT
TAAATTCACAATAAGCTTAAAAATATTTCATTTTTTATAAAATATGTATTAATTATTTAT
ATTTTTTGTATAAATAAATTTTCTATTAGCCCAAACTGTTACTGTTTAGCAAGTTTTAAA
TCCTTCCACTAAAGGTGGAGTAGGAAGTTTTATACTCCAAACATTATAAGGATAGAATAT
CGTAGATTAGAATAAAATTTTTGGAATTATTGGAATAGCTGATATCTCAACAAATCTAAT
TTCTGCTAACATTTAGGTTAATCCTTCAGGTAGTGATCTAGCTGGAGACTACACTTCATA
TTAGCTCACCTTTTAAACAGCTAGTAACATACCTGCAGGAAGTTATTTTATCCTATAGAT
CCCAACAGATTTTACCTTAGAAGTAAACATAATATATTTTATATTTATATAAAGCAAAGT
CTATAAAGCATACATTAAAAAATATTTATAAAGACCTTTTGACTAGTTGATTGATTAATA
ATAGTTAAAGAGAAGATATTATTGAAATAAATAAATAAAATGAATTTAAATTATAAATGA
AATAATTAATAAATTATTTTTAAAATAGGACTATCCTACATGCATATCACCAAGTTTAAA
TGGTTACTTTATAGCTGGTCAGCTTATATGCACTTTATAAAGTAATAATTAGGTTAGAAT
AGATGGAGTAGTAGGAGTTCTCACCTAAGGTATCAATTATGTCTTATAAATTTCAATGCA
AAATCCTCCATACACTATTAATCCTAACACAGCTAGTAGTAACTATGTCTTCTCTTTCTA
AATTTACAAACAAGGAACTCAAATATTATTTGAAAGTATCTCTGGCATTTAGGGTCCTGC
AATCAATGCTGCTGGATTAAATAATATCTCTTTAACTCCTACAGATTAATTAAACTTAAA
TAACAGATATATCTATGCCGAATACAAGCTAAACTTTACACCAACTCTGGCGCTTGAAAA
TGGTAAATTAATTATAAATTAATCTATTTTCTAATGATAATATAAAATTTCAAGCAAATT
AGCTAGCTGTACCCACACATAGTCTATTAAAAAATTTACTTATTTACTCATTTTATTTAC
TTAATTTTGGTCAAATTTAAACTTTCAAAAAAACCAAAAATTTCTTTTTATTAATTATTG
AACTAGATTTGAATATTTATTTATTTATTATAAAAAATGAATAAAAACAACCTGCATTTG
TTTGTCAAAAGTCACAATTTACTCAAAATTTTTTTTGAATTTAAATAATAATAGGAAATT
GTATAGTAATATCATTCCCTGCTTATTTTTAGGTATTAGTAAGTTAGTAATTAATGTACT
TGTAGGAAAATATGTATTAATTGCATTATATAAATTATGGACTTGATAATTTATCAGAAA
ATAATAAAGTTTAAATCTCAGTCAGTTCAAATTCTATTATCATTTCGAACTTTGCTACAC
AGCAGTTCATTTAAGAAATATCAGTTATTATCATGACAAGAAACCCAGATGCAGCTGGAA
CAGCTACTCCATTGAAGATATACATATACCAAGATACTACCTAGTCTACTTTAATAGCAT
AAGATGTGAATTCTGCTACTGCTAATATAGATCCTTATAGTAACATATCATTTTTAATAT
TGTTGAAAATAATTTGGCTTTTTTAAAAAAAGCATCATGTGACCATTCAACTGATTAGAT
TTTAGCAAGTATCAACTACTATCTATGGAATAATGCTTGGCCTAAGGCAACTTAAACTCC
AGTTGTAATTCCTTCAATTTAATTTGAGTTTAAACCTTTGAAAACTATTCCTATTGGAGG
GTTAATCAAAATAGCAATTCCTAAAGAATTCACCTTTAATCCTGCATTTCGTAATTCATA
TTTTTCAATTTATAAAATTTATTAAATTCAAATAATTAAGAATACAAATAAATAATTACA
TTCATAAAAATTCTAATTTTATCAAAATTTATTAGATTTTTGTAATTTTAATTATATTTA
TTTTAATGCCAAAAGCTACAACTGCGACTGACTGTGGTATTTATTATGGATATTCTTAGT
TTACCATGACTGCAGGAAATACCCCTTAATTTAATAACATATATCCTTCATAAAGATAAA
GATCTACTCTCTTTTAAACTTATCAGCCTGTTGGAACTGCTGGTTCTAATTCTTTTGCAT
GCTAAACTTCAATTACAGGAAATATAATGACAATATCTGGCATTCAGAATACAGTAATTA
AACTAATCATATGATACTTTAAATTTATCATTTTTTTAATTTTAGCTTTTTGGGAACCAG
GGACTCATTCATATATTGGTATTAAAAAATTGGGTTATGACTCCAGCAAGAAATGCGTAT
GTTTATTTATTTATTTATTTGTTATATTAAAGCATAATTATTTTTAATTAGAACTTACTT
TTTTGCCTTAACGTCTTATGACAGTGACAAATATACAATCTTAGAGTCATGGAAAGATGC
ATTTTAAATAAACCCAAAAGATGTAAATTATAATAATATCAATACTATTTTTAAAACTTT
AATTAAATATATCTCAATTAAAGCTTACAACAACTCCAGTAGTCAATCTGATAAATAATT
ACGTTTCTAGTGTAGCTACTATCTCAAAATCTATATTAGATATTTAATTAACAACAGACA
TAACTATCCCTAGTGGCTAACCAATATATAAATCAACTGATACTTAAGGATTTATTTAAT
TAGATTTTAGGTAATTATCAGGTGGTGATGCATGGTAGCTTGGACTTGGTCTTAATGTAC
CCAGTGGGACATAAATACCATGTAGAGGTATTTAAGGAATCATACCCATTTAAGGATCAT
CAATTATTTGTACTTATGTATAGGCATCATACACTGCTTTAACCACTACTACATTTTCTT
AGATCTTCATAAAAAATTTTGTGTAATATTCAATTATTTATTTTATGAGTAAAGGATTTC
ATACTAAGTTAATTAATGCTCATATTTTGACAACATATTTAATTTCTTCCTTAATTAAAA
AAACCTAATTAAAAAACAAAATTAATATAATTAATAAAAATTAGACAAATTCCAGCAAAC
ACTTTAGTTAGAATTCATATTCCTAACCTTCTTAATCCTTAAGGAGGTGGAACTACTTCT
GATTTATCAATAAGACTTGTTTCAAACACAAATAATGTTTATTAATATTTAGCTTAAAAA
TCGATTTTAATTACAGATAAACGTAAAATTTTAATTTATATTTCTACTTAGTTTTTTTTA
TATTTTATTTTTTAAATATTTGAAAATTATTTTAGTATTTCCTCTCATTTAGGTTTATAA
AAATATTATTTATTTAATTATGAATTAGCTATTGGTACTTTTGTTGTTTAAAATGTATTG
AATCTCAGCTATTCAACTAATTATGTGGGATAAACATTCAATTTAGGTTTTAATACAAAA
ACCTCACCCTCTGCAGGAGATTTACTCCTTATTTAGCTACCAACGTTCTCAAACGGTTTC
ATAGTTCAAGACTAAACTATCTCATGCTCAGTAAACTCTATCAATATGTATTGCATTCCA
TACTATTAAGCTGATATGATCTTAATTATGATTTCTTAAAATTTTGCATCACCATAATAA
TCAATTTTGATATCAAATATAAACTGGCCTCAATATCAAAGTAACTTCGTTGCAACTTTT
TCAACTCTCGATGTATATTGGACATCTTCGACAGGAGTTACAAATAAGGCTGAAAGAAAT
AACTAATTAATTAACAACCTTCCAAACTAATTTTCTAATGCATCGATTGTTATCCCTAAA
AAAGTATTAAATTTAAATAAAAATAAAAATAAAATAAAATAAATTTTTTTTATTAATAGG
GAATTCAATATGTAGATTGCTCTTACCAGTTTAGTTTCACTGGTAATGCTGATATTCCAG
CCTTGAGCTTGATATAAGTTATATTCCCCAATAATTACAACCTGTTAGGATCTACCCCAC
TGCCAACAGTGACATACTCAGGGTTGACTAGCTATAGTTCTTCACAACAACTATCTATTT
AAATAACAATTTAAATGATTACAGTAGATTAATAAATGATTTAACATAAATTTTTTAAAA
TTAATATAAAAAATAGATTTCAAATAATTAATATCTGCCAGCAGGTTCTACATTTACAGT
AACAGTTTCAGGAGTTAAGAATCCTTCAACTATGCCTGCTAATGGTCTATCTACTGGATG
GGGAATTCAAGTAGTATAGTACGATGCTGTAAATGATATCAGTAATTTAGTTATGCAATA
ACTAAACTTTTACAGCTTCGCTTTTGATCCAGTTTTCACACCTGGGACAATTGTTTTCAA
TTCAATTACAGCTTTTCCACTCAATGCTGACGAAACTGCAACTTATACTATTCAGTTCAC
TCCATATACTAACATACCTATTTAGGGTGTCATCTAAATTACTTTTCCTTAAAATAATTT
TAAAGTATTTTAATTAAATTTACATTTCAATGATCAATCAATTTAATGTTTTTAAAAAAC
TAGTCTCTCCCCTCTCCTCCAAACTGTAGTATGGGAGGAGCAGTTACAACTTTTAGTAGT
TGTACTCTTAGTGGCTCTACTTTCTCAATTGTGATTTAAGATTAGTATAATTCTGGTAGT
GGAAGTATCACTTTATCCATAACTAATATAAAAAACCCAGATTAAGGTACTTCAGATGGC
TTCATAATAGAAACAACTTACGACGGTCAGACTTTAGATATTACAGATTAAACCACTTTG
AGTAGTAGAACAATAACTACAGTCTAAAGAGCTCCTGAAATTACTGTAAACTCTATTACC
TTTAGTCCATAAAATATAAGCGAAAGAAGTACATACACCTTCTCATTTATTACAAGTGAT
ATCATCACTTCTTAAATGTAAATTCTATTCTAGTTCCCATCAGACTATGATAAGCTATTA
GGAAAAAACGTTAAGTGTATTATAGTCTCTGGTATATTAGGTAAATAAATAAACAATCTA
TCAAATAATCAAATGAGATTATTTCTAAAAATGAAATTGATGATTTTTTTTAAAATATTT
TTTAGGTAATTTTTATAGTTGTTATGTGTAAAATGGCGGAGTTTATTTATAGAATTTTGA
TTCTTATCAACCAAGTAGCTCAAATCCTATAGTTGTTCAGATATTTGGTGTAACAAACCC
TAATATAGCTTATACTAATACTGGTTAGTTCTCGATATCATTGCTATATAAAGGGGATAA
CAAATTCATCAATTCATAATCTTAGGCAGGATAATTATAAATGTACGGAAATCCAGGATG
GTTATCTGTTTAGACTGTAACAGCTAGTTAATTTAATGTGAGGTACACTGCTAGTTATTA
ATTTTCTTTTACTCTAAGTAAGAATGTTCCAAAGATTTTATCATAAGGAGCAATATTTAT
AGATTTTCCTCCTTAATTTGATTAAGTCTCAGACGGAAGAGGCTCTTGTACAACTACAAC
AGCTTCTTTCGCTTAGGTTATAGATTGTTACACCATTCAAAATCGTTACAATGTAACAGG
TAATACTCAAGATTTCTCTGGTTAGCTTTAGGTATCAATAGCGTCGGTTCTAAATCCTAC
TTTCTAAGGAATTACTGATAACTTTTATGTAAGTTCATTTGATGGCATAAACCAAATTAT
TATTGATAGAAGCTACATAAATTTAGATCCATTTTCATTTAGCTACGTTTATCCTGGTCC
ACTGATTCACGTAAATAATGATTAAGGCATCTCACTCTACCCTGGTACATAAACTGTTGA
TCTATATATTACACTAGATTTCCCTTCATTACTTGAGTTAAGTGTAAAGCCAAATATCTT
ACCAGGTTTCAAAGTAATCCCATTCGACATTCCTATTCATCTAGGTTAGACATCCATCCC
TTTCAGAATATCCTGCCCATAATAAATATTTTCTGGTTCTTATACACTCTAATGGGTAAC
ACTAGGAGATAATGTGCCTCCCATCTACACACCAATATAAACTTCTTAAATTACTATCCT
CAATCCTACAAGTAAAAAAAAAAAATAAAATTATAGCTTATTAAAATTATTTAAAATTTA
TTGATTTTTTACTTTAAGGTTGATATTAAATTATTATGATATCAAATTAAAAAAGTAAGT
CAAATTTTTTAGTTTTTATTAAAAACAGGAAAAAAAATTAATTTTTAAATAAATTTTGAA
ACTTAAAGATAAAATTTTTATAAAAATCTTTAATATTTTATTTAATACAATTAAATTAAT
AAAACAAATTTAACACAAATGTTCCTTTTAAAAATCAAAGATTTGAATAGTTTTATTAGT
AATATAAATTTTAATTAAACTAATTAAAATGAAAAATATATATTAATTCACTAACTAAAC
ATTTACTAAATTTTATATTTTAAAAAAGAAAATAGCTTGAAACTAATTTTCTTTCTTTTT
TTATTTTATCTTTTTTAATTTTTGTTAAATAGCCAAAAAAAAAATTTTATAATAAATTAT
ATAATTTTTGTTTGAATCAATAGTTTAAACTGTGCTCATGAACTCTATCTTAGATATTCC
TTATGGAGGAACTTCTTTAGACACAATACTTTCTGTGACTTATGCATCTGATATTTATTT
TGAAGTCCATATGAATTTAGCCTCTTAGTATCCAGGAATTTCATTAAGTACTTAAATGCT
AAATTTCACCAAAGGAATAAACTAGCTCAGTTTTAGAGTTATTTCTACTCCTACAAATAA
TACTAGTTCATCTGTTTCAAGAGGTTCTATAGTTTTCTCATTATTGGGAATAGATTCAAC
TATATTTTAACTACAATATACTTAAATGTACTTCAATTTAATAGCGGCTGATAACATAGC
ACCTCAAATTATTTAGCTTCAGACAGTTAATATATTAAAAAATAGTGTTTAAATTAACGT
TATGACTAATGAACCAACTGTAGTTTACTATATGTGTAGTTTAAATGGAACATCATATCC
AAGCTTCTCTTAAGTTTTTAATAAAACTGCTCCTCCTGCCAATACTACTTAAAGCTAATA
TGGATAATTAGTCTTAAATTAAGCTAATGCAAACTTTTACTTTAACATAACAAACCTCAC
TGCCCAAACTCCTTATATCATCCATCTATTTTTCTAAGATAGAGGAAATAATGTTGCAAA
TAAGACTCTAACTTTTGTCACAAGCAGTAAATTTAATTTAAAGTAAATTTTATCACTAAT
TAACATCATTAACAAAAAGATCGATATAATGCCGCAACATTTAGTCTGAGATTCTAAGTC
CTTTAACTATCAGCTACTGAAATCAAGAGCGTGCTTATTAATTTATCGAATATTTTAACT
ATTGATTTGAATACGTAAATTAATAAATAGAAATTTAAATAAATTAATTTTAATTTTAAT
TTTATATCATCAATTTTTATTAATATTATTTTTGAATTGGTTGTTTTCGTTTTCGCTTAT
TAATTAAAAAAAATTTACTAAATTTATAACTACAAATTTATTAAATAGCTTGTACATCTA
GAAATATTATTTTAATAATACCTCCTCAAGTACTAGCTCAAGTAGAATTCTGTAAAGCAC
ACAATTAGCTGATTAAATAAACCAAATTTAAGAAACTACAGATAATCAAGGTAATTAAAA
AAGATAAAAGGCTAATAGAATATTAGATGTTTCGACTTCAATTTATACTTTACTGAACAT
CTAAATATCTTCAAATAGACTCGTAGAGTATTATCCTTCGCCATTAACTTTAGCTAATTC
TTTGAACAATAAAACTGTATTGCTGAAAGCTGCAATGCCCACTTATGATAGCTCGTATTT
AGTAATCCCAAACACATTTGTATCCTACTATCCTAATTTTATTTAGCCTCCTTAATTTTT
GTCTAATGACTGGTCTACTGCTAATTTCACAGTCGTCTTAGACTAACCAGGATTTGTTTA
TGTGACTGGAGAGTTATATGTCTCAAATACCTAGCCCTCTCCTTATCCTGATTAAATTTA
TTGGGGTTATGACCATACAAACATTAAAGCACCTAGCGGATATGTAGAAGTAAGCTAAGG
ATATACTTAATTTAACTTAACTCTACGTAACCTTAAACCAAATTCAAAGTATTTTGCTTA
CATAATTGGAGGAAGTGTCCAGCCTGGATACCCAGATTTAATGGACGCATCCAAAATAGT
AAGAATTTAATTTACAACACTTCCTTCACCTTCAGGTAAATTTAATTTACTTTAAAGAAA
AAATGTGAAAATTAAATATTTTTAATTAATGAATATAGATTTAGAACTAGATATAAATAC
TGGAACCAAATTAGAATTTAGCACTAAATTTCTAGTGCTACTATTTTTAATTATTTAAGT
ATTCATATGA


>TTHERM_00621610(protein)
MQQLIFLLATIYQILRTTQAGTITPTTQPPPIYNTLANAGVRADYTFSFIPQTFLPAGGN
LQIIFPSQYSATQAFQINNLVCSVTCQASGLTLTFTFPYDLAAGIAQTVTVQQVLNPSTK
GGVGSFILQTLQGQNIVDQNKIFGIIGIADISTNLISANIQVNPSGSDLAGDYTSYQLTF
QTASNIPAGSYFILQIPTDFTLEDYPTCISPSLNGYFIAGQLICTLQSNNQVRIDGVVGV
LTQGINYVLQISMQNPPYTINPNTASSNYVFSFQIYKQGTQILFESISGIQGPAINAAGL
NNISLTPTDQLNLNNRYIYAEYKLNFTPTLALENGNCIVISFPAYFQVLVSQQLMYLQEN
MYQLHYINYGLDNLSENNKVQISVSSNSIIISNFATQQFIQEISVIIMTRNPDAAGTATP
LKIYIYQDTTQSTLIAQDVNSATANIDPYTSCDHSTDQILASINYYLWNNAWPKATQTPV
VIPSIQFEFKPLKTIPIGGLIKIAIPKEFTFNPAFPTTATDCGIYYGYSQFTMTAGNTPQ
FNNIYPSQRQRSTLFQTYQPVGTAGSNSFACQTSITGNIMTISGIQNTLFGNQGLIHILV
LKNWVMTPARNATYFFALTSYDSDKYTILESWKDAFQINPKDLTTTPVVNLINNYVSSVA
TISKSILDIQLTTDITIPSGQPIYKSTDTQGFIQLDFRQLSGGDAWQLGLGLNVPSGTQI
PCRGIQGIIPIQGSSIICTYVQASYTALTTTTFSQIFIKNFVQIPANTLVRIHIPNLLNP
QGGGTTSDLSIRLVSNTNNVYQYLAQKSILITDKPIGTFVVQNVLNLSYSTNYVGQTFNL
GFNTKTSPSAGDLLLIQLPTFSNGFIVQDQTISCSVNSINMYCIPYYQADMILIMISQNF
ASPQQSILISNINWPQYQSNFVATFSTLDVYWTSSTGVTNKAERNNQLINNLPNQFSNAS
IVIPKKGIQYVDCSYQFSFTGNADIPALSLIQVIFPNNYNLLGSTPLPTVTYSGLTSYSS
SQQLSIQITIQMITISNNQYLPAGSTFTVTVSGVKNPSTMPANGLSTGWGIQVVQYDAVN
DISNLVMQQLNFYSFAFDPVFTPGTIVFNSITAFPLNADETATYTIQFTPYTNIPIQGVI
QITFPQNNFKSLPSPPNCSMGGAVTTFSSCTLSGSTFSIVIQDQYNSGSGSITLSITNIK
NPDQGTSDGFIIETTYDGQTLDITDQTTLSSRTITTVQRAPEITVNSITFSPQNISERST
YTFSFITSDIITSQMQILFQFPSDYDKLLGKNVKCIIVSGILGNFYSCYVQNGGVYLQNF
DSYQPSSSNPIVVQIFGVTNPNIAYTNTGQFSISLLYKGDNKFINSQSQAGQLQMYGNPG
WLSVQTVTASQFNVRYTASYQFSFTLSKNVPKILSQGAIFIDFPPQFDQVSDGRGSCTTT
TASFAQVIDCYTIQNRYNVTGNTQDFSGQLQVSIASVLNPTFQGITDNFYVSSFDGINQI
IIDRSYINLDPFSFSYVYPGPLIHVNNDQGISLYPGTQTVDLYITLDFPSLLELSVKPNI
LPGFKVIPFDIPIHLGQTSIPFRISCPQQIFSGSYTLQWVTLGDNVPPIYTPIQTSQITI
LNPTIQTVLMNSILDIPYGGTSLDTILSVTYASDIYFEVHMNLASQYPGISLSTQMLNFT
KGINQLSFRVISTPTNNTSSSVSRGSIVFSLLGIDSTIFQLQYTQMYFNLIAADNIAPQI
IQLQTVNILKNSVQINVMTNEPTVVYYMCSLNGTSYPSFSQVFNKTAPPANTTQSQYGQL
VLNQANANFYFNITNLTAQTPYIIHLFFQDRGNNVANKTLTFVTSNRYNAATFSLRFQVL
QLSATEIKSVLINLSNILTIDLNTLYIQKYYFNNTSSSTSSSRILQSTQLADQINQIQET
TDNQGNQKRQKANRILDVSTSIYTLLNIQISSNRLVEYYPSPLTLANSLNNKTVLLKAAM
PTYDSSYLVIPNTFVSYYPNFIQPPQFLSNDWSTANFTVVLDQPGFVYVTGELYVSNTQP
SPYPDQIYWGYDHTNIKAPSGYVEVSQGYTQFNLTLRNLKPNSKYFAYIIGGSVQPGYPD
LMDASKIVRIQFTTLPSPSDLELDINTGTKLEFSTKFLVLLFLIIQVFI