Identifiers and Description

Gene Model Identifier

TTHERM_00622790

Standard Name

MPP10 (U3 small nucleolar ribonucleoprotein protein MPP10)

Aliases

PreTt07366 | 87.m00146 | 3814.m00852

Description

MPP10 Mpp10 protein; Mpp10 protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_11952.1 9.997093137033517e-262
Description: Mpp10 protein (639 aa)
DictyBase DDB_G0279245 5.999781043483669e-32
Description: mpp10 on chromosome: 3 position 1824604 to 1827101
Oxytricha Contig21586.0.g100 1.9996410647472548e-29
Description: Mpp10 protein
SGD YJR002W 1.0004572433669413e-23
Description: MPP10 Component of the SSU processome and 90S preribosome, required for pre-18S rRNA processing, interacts with and controls the stability of Imp3p and Imp4p, essential for viability; similar to human Mpp10p
Stentor Coeruleus SteCoe_28836 1.4251640827409352e-21
Description: None
WormBase WBGene00013544 2.0002795641672355e-21
Description: status:Partially_confirmed UniProt:Q9XW58 protein_id:CAA22114.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00622790(coding)
ATGAGTACAGCTAATTTTGATTTAATACATTCTTTTTCAAAGAATTTGATAAGTTAACCA
TAGATTATTGTAGAAAATGAGGATGATAAGGTCTCAAAATAAGCTCTTTCTATGATTAAA
TAATTGCATGATAATTTGATTAATCAAAGTAAAAAATTTAAAATAAAAAATGAAAATCTC
GTAGTTAAAAATATGAATGAAGAATAAATATGGGAACAAATAAATATTCATTTAGATACC
CTTGATAAGGCATTCGAAAAATACATTAATACTCTTCCTGAAGAGAAAGAATCTTAGTAA
TCTGATGATGAAATTGATGATAGTATAGATATGGATCTTGAAAAATCAAAATCAAAATCA
AAGTCTTTGAAAAAATAAAAAAAATAATTAGAAGACTCAGATAATGATGATGATGATGAC
GATGAAGAAGATGATGGCAATCTTCATTTAGAATCAGAGTATGAAGATGATGAAAGCGAA
TAGGAATAAGGATAAAAATAAAAAAATTAAAAATCACTCAAAAAATAAAAGGATCAATAA
GTAGAAGATGAAGATGAAGATGCTGAAGATGATGAAGAAGAAGATGATGATGATGATATT
GATGCAGACATTGATGCAAAAGATTTCTTTGATAATGGTGATGAAAAAGATGAAAAAGAT
GAAAAAGACTATGAAGAGTAGTTAGATTTTAAAGAAATGGAAGCTTTCTTAGATAAGTAA
GATGCTGAAGACATTGAGAGAGATAGTGAAGTTGAAGAAGAGTTAGGAAGTGATTATGAA
TTAGATGATGGCGATTCAATGATGGGAGAAGGCGAAAACGGATTTAAATTTAAGGGAAAA
GACGATTATGATGAAATGGAAGAAGAAGAAGGTGAGGGTGATAATGAAGAAAATGAAAAA
CTCCGTGAATAGGATTATGATGCAGAAGATGAAATTTTTGATTTAGAAAGAGAGCATGAA
ATAAATTAAGAAAATAAAAAAGATGAGGATATGGAAAAGTTAAGGAATGATGATGAAATT
GATAGATTAGAAAAAAGACTAATTGATGAAAAAGTATGGCTTCTTAAGGGTGAAGCTAAT
GCTAAGCATAGACCTGTTAATAGTTTATTAGACTAAGAAGTTGATTTTAGAAAAAATATT
AAAGTTACTTAAGAAATAGATGAAAAATATAATAAGAATTTAGAAGCTATTATTAAATAG
CGTATTCTAGATGAAGCATATGATGATAGATAAAAAATTAACATAGAATAAAATTTCAAG
GAAACTTTTAATAGTTTTGCAGAAATATCTAAAGAATAAAGTAAGTTAGGTTTAGGAGAA
CTTTATGAACAAGATTTTAAGAACAGCTTAGGACTTCCTTCCAACAATAAAGAAGATAAG
CTTAAATTAGAAATACATAATCTTTTTAAGGAAGTTTGCTACAAGTTGGATGCATTATCT
AACTTGAGCTTTACACCTAAACCTATTATGCAATAAGCTTAAATAACTACTAATGTACCC
TCTTTAAAACATGAAGAGAGAATACCAATTAGTGTTTCTTAAGCAGACACTTAACGTCCT
GAAGAAGTATTTGATAAAAAGAAACAAGTTACTCACTAAAGTAAGGTAGAGATGACACAC
GAAGAAAAGCAAACAGAAAGAAGATAAAAGAAATCTGCTCAAAGATAGAGAAATAAAGAA
AAGGAAAAGAAAAACCTAATTAAAAACTTATAATATAAGGGATAAACTAAATTTGAGTAT
AACTAATCTCAAAAAGCCAAAGCAAATGCCAAGAAATTGGTAGAAAATAAAAGATAAAAG
AGTGTAGAATTTACCAAATCAAGCGAATTCTTTAGGAACATGCAAAATAACTAATAGTTA
GAAGCTTCTGGTAAAAATAATTAGGCTGGAAATAAAACTAAATCTATTAAAAAAAAATCC
AAATGA


>TTHERM_00622790(gene)
ATGAGTACAGCTAATTTTGATTTAATACATTCTTTTTCAAAGAATTTGATAAGTTAACCA
TAGATTATTGTAGAAAATGAGGATGATAAGGTCTCAAAATAAGCTCTTTCTATGATTAAA
TAATTGCATGATAATTTGATTAATCAAAGTAAAAAATTTAAAATAAAAAATGAAAATCTC
GTAGTTAAAAATATGAATGAAGAATAAATATGGGAACAAATAAATATTCATTTAGATACC
CTTGATAAGGCATTCGAAAAATACATTAATACTCTTCCTGAAGAGAAAGAATCTTAGTAA
TCTGATGATGAAATTGATGATAGTATAGATATGGATCTTGAAAAATCAAAATCAAAATCA
AAGTCTTTGAAAAAATAAAAAAAATAATTAGAAGACTCAGATAATGATGATGATGATGAC
GATGAAGAAGATGATGGCAATCTTCATTTAGAATCAGAGTATGAAGATGATGAAAGCGAA
TAGGAATAAGGATAAAAATAAAAAAATTAAAAATCACTCAAAAAATAAAAGGATCAATAA
GTAGAAGATGAAGATGAAGATGCTGAAGATGATGAAGAAGAAGATGATGATGATGATATT
GATGCAGACATTGATGCAAAAGATTTCTTTGATAATGGTGATGAAAAAGATGAAAAAGAT
GAAAAAGACTATGAAGAGTAGTTAGATTTTAAAGAAATGGAAGCTTTCTTAGATAAGTAA
GATGCTGAAGACATTGAGAGAGATAGTGAAGTTGAAGAAGAGTTAGGAAGTGATTATGAA
TTAGATGATGGCGATTCAATGATGGGAGAAGGCGAAAACGGATTTAAATTTAAGGGAAAA
GACGATTATGATGAAATGGAAGAAGAAGAAGGTGAGGGTGATAATGAAGAAAATGAAAAA
CTCCGTGAATAGGATTATGATGCAGAAGATGAAATTTTTGATTTAGAAAGAGAGCATGAA
ATAAATTAAGAAAATAAAAAAGATGAGGATATGTAAAATTTATGTTTCAATTATCACAAT
TTGCATGTTATTTTTAAAAATTATTTAATAGGGAAAAGTTAAGGAATGATGATGAAATTG
ATAGATTAGAAAAAAGACTAATTGATGAAAAAGTATGGCTTCTTAAGGGTGAAGCTAATG
CTAAGCATAGACCTGTTAATAGTTTATTAGACTAAGAAGTTGATTTTAGAAAAAATATTA
AAGTTACTTAAGAAATAGATGAAAAATATAATAAGAATTTAGAAGCTATTATTAAATAGC
GTATTCTAGATGAAGCATATGATGATAGATAAAAAATTAACATAGAATAAAATTTCAAGG
AAACTTTTAATAGTTTTGCAGAAATATCTAAAGAATAAAGTAAGTTAGGTTTAGGAGAAC
TTTATGAACAAGATTTTAAGAACAGCTTAGGACTTCCTTCCAACAATAAAGAAGATAAGC
TTAAATTAGAAATACATAATCTTTTTAAGGAAGTTTGCTACAAGTTGGATGCATTATCTA
ACTTGAGCTTTACACCTAAACCTATTATGCAATAAGCTTAAATAACTACTAATGTACCCT
CTTTAAAACATGAAGAGAGAATACCAATTAGTGTTTCTTAAGCAGACACTTAACGTCCTG
AAGAAGTATTTGATAAAAAGAAACAAGTTACTCACTAAAGTAAGGTAGAGATGACACACG
AAGAAAAGCAAACAGAAAGAAGATAAAAGAAATCTGCTCAAAGATAGAGAAATAAAGAAA
AGGAAAAGAAAAACCTAATTAAAAACTTATAATATAAGGGATAAACTAAATTTGAGTATA
ACTAATCTCAAAAAGCCAAAGCAAATGCCAAGAAATTGGTAGAAAATAAAAGATAAAAGA
GTGTAGAATTTACCAAATCAAGCGAATTCTTTAGGAACATGCAAAATAACTAATAGTTAG
AAGCTTCTGGTAAAAATAATTAGGCTGGAAATAAAACTAAATCTATTAAAAAAAAATCCA
AATGA


>TTHERM_00622790(protein)
MSTANFDLIHSFSKNLISQPQIIVENEDDKVSKQALSMIKQLHDNLINQSKKFKIKNENL
VVKNMNEEQIWEQINIHLDTLDKAFEKYINTLPEEKESQQSDDEIDDSIDMDLEKSKSKS
KSLKKQKKQLEDSDNDDDDDDEEDDGNLHLESEYEDDESEQEQGQKQKNQKSLKKQKDQQ
VEDEDEDAEDDEEEDDDDDIDADIDAKDFFDNGDEKDEKDEKDYEEQLDFKEMEAFLDKQ
DAEDIERDSEVEEELGSDYELDDGDSMMGEGENGFKFKGKDDYDEMEEEEGEGDNEENEK
LREQDYDAEDEIFDLEREHEINQENKKDEDMEKLRNDDEIDRLEKRLIDEKVWLLKGEAN
AKHRPVNSLLDQEVDFRKNIKVTQEIDEKYNKNLEAIIKQRILDEAYDDRQKINIEQNFK
ETFNSFAEISKEQSKLGLGELYEQDFKNSLGLPSNNKEDKLKLEIHNLFKEVCYKLDALS
NLSFTPKPIMQQAQITTNVPSLKHEERIPISVSQADTQRPEEVFDKKKQVTHQSKVEMTH
EEKQTERRQKKSAQRQRNKEKEKKNLIKNLQYKGQTKFEYNQSQKAKANAKKLVENKRQK
SVEFTKSSEFFRNMQNNQQLEASGKNNQAGNKTKSIKKKSK