Identifiers and Description

Gene Model Identifier

TTHERM_00622800

Standard Name

NUP93 (NUcleoPorin Nup93p)

Aliases

PreTt07367 | 87.m00147 | 3814.m00853 | Nup93

Description

nucleoporin putative; Nucleoporin- nup93p; common to both macronucleus and micronucleus NPCs

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

  • obsolete manganese resistance permease activity (IEA) | GO:0015096
  • succinate-semialdehyde dehydrogenase [NAD(P)+] activity (IEA) | GO:0009013

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_11953.1 9.997093137033517e-262
Description: hypothetical protein (962 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:28386019: Iwamoto M, Osakada H, Mori C, Fukuda Y, Nagao K, Obuse C, Hiraoka Y, Haraguchi T (2017) Compositionally distinct nuclear pore complexes of functionally distinct dimorphic nuclei in the ciliate Tetrahymena. Journal of cell science 130(10):1822-1834
  2. Ref:25788697: Iwamoto M, Koujin T, Osakada H, Mori C, Kojidani T, Matsuda A, Asakawa H, Hiraoka Y, Haraguchi T (2015) Biased assembly of the nuclear pore complex is required for somatic and germline nuclear differentiation in Tetrahymena. Journal of cell science 128(9):1812-23
  3. Ref:19375312: Iwamoto M, Mori C, Kojidani T, Bunai F, Hori T, Fukagawa T, Hiraoka Y, Haraguchi T (2009) Two distinct repeat sequences of Nup98 nucleoporins characterize dual nuclei in the binucleated ciliate tetrahymena. Current biology : CB 19(10):843-7

Sequences

>TTHERM_00622800(coding)
ATGAGTTTTACTGTTGCTCGCGATGATAATAGGGACAAGCGTGGTTAAAATCAAACTGAA
GTTATGGAATAAAGACTTAAAAAATTATATCAGGATATTAGCATCCTTTAATCCAGAACA
GGAATCAAAAAGTAGCAAGTGAGCTAAAAAAATCTTGATTAGTTAATGTCTCTTTTAAAC
AAAAAGATATAGCAATATAGTTTTCCAGACACAATTATTGGATAAAACCACTACAAATTA
GTCTAAAAAGGCATGGATGCTCCTTCCCTTGAGCGTAAATTGCAGGAATAGAGATTTTTA
GCAGAAAAAGAATTGAGTAGTAAATCTAATTAAGAAAAGAGCCTATTTTGGATGGATATT
GTATTCTCAAAAGAAGGAATTGATACTTATTTAGAAAACAATCAAAACTATTTAATGTTT
AACTCTGTCGATACTATGAGAAGCCGTAACTCGAAAGGGGAAACTTTTGCTACTCGTTTG
CTTGCAAAAAAATCCTAACTTCGTGGTATTCTTGGTGATACTTATAGAGGAAATGTTGCA
GCATTAGCATCTGCACCAGGATTTAAGTACGATTAATTTCATCGCTTTGAGTAAGAGTCA
TCTTAAAATATTGATGATTATATTAAAGCTATGAGTTAATTTTAGTAAGGAAATTACACA
AAGTACTGTGATTATCTTGCAAAGAAATCAATTGATTATAAAGAGGTTTGGTAACTTTTA
GAGAAGATGGTTCCTACAGATGGATCAAACATATTTAAAATAAGTAAGAGATTGCAACGT
TTAAGAAAATCTGGGTAGTAGAATTAAAATTAATTACAATGCTTGTAAAATAATTTCAAT
TTGTAAAATGCTTATCATAATGGTATTTAGTATCTCCAATAAATTTACCGTAAAAATGCT
AAATAAAAAAAGCAAAACTTTTAGAGAATCTACGATGTTTATAATGTTGATTAGATCCGT
GGTTTTGATGATGATAATATCCCTATATGGTAAGAAATTTATCAGTTATTTAGAGCTGGT
GATTACGATGGTATTTTTAATCGCTGCCAATATTTCTCCAATGTAAGTGAAATTTAAGAG
TTTTAAAAAGATCTTGACATTTGGCTCAAAAGTGGATAACGTAAAAATAACTAACTAAGC
TAAAAAATACGTCCTAATTGGGATGCTTTCCGTTATCAAATATACCTCATTATGATAAAA
GACCCTTCTTGTGTCGACGACGTCTTTATTGAAGATTTAGATGACTGCCTATGGATGAAC
TTAAAATGCAGTGAAGTTTATGTTCCTCCTAACTAACAAGATCCTATTAATCCTATGAAC
ATCGAAGACGATATTGAAGATTAATACGAAGTACTTAATGGAAATAATCTCAGCACTAAC
GTATTAAATTAATCTGTTTAAGAGGATGAAAAAGATAATTTTTATGATACTGTTTTAAAA
GCAAGCTTAGACATTTCTCAAGATGAAATTCTTCCAGGAGAAGATGTTTACTCATGGATA
GACTGGAATTAGTTGCAAGACTTAAGGAAAATGCTTTATGAATCTTTCAAGGAATCTCCA
GATGTCTTTAATCCTTCTCGTGTTCTTATGATCTAATTGCTAACTCTAGATTTCATTGGT
TTTGTACAAACACTTTTACAATTAGAAAAAAGTGCTATCTCTCAACATGAATTCACTCAT
TTCTTAATTTTAATCTTAAAAACTGGTTTGGTGCGTGCTTCTGTTGAATGTTCTGTCAAA
TTTGCTGAATCTGGAAATTCATCCTATGGAGAAAGTAAGGACATTCTTGTAAGAAGATGC
AAGGAATTCGAAGAAAGCGCAGAGAAAAAAATAATTCTTTATGCTAAAGATAGATTTGAT
AATTATCCAGATACTTGTTTTTCTTATATTGAATCTCTTCCTATAAAAGTTGAGGATTAA
TTGAAAAAGTATGCAAATATCTATGTTGGATCTAAATAAAATTTTATCCATCTGTTTAAG
CCAAACCTTAATTTCTCTTAATAGCTTGATTCTAATTCAATGACTTCGAATAATAGTCAA
TCATAAAACAGAGGAAAAGTTTTTGACTAAATTTGTAAAATAAATAATCGTCTAAAAAAG
ATAACTTACACAACTAAGGCATAACTAAGAACAGGATAGAATGTTCAAAGCGAAAATTTA
CTTACACTTTTAGCCAAAATAGTAGCATAAACCTACATTCAAACATAGAATAAGGTAGAA
GTAGCTCTTGAAATTCTTGATAACGTAGGTGCCTTTGAAGATATTGGTAGAATATTGAAG
GAATAATTCCGCTTATGCACTTCTCTTTCATAGAATCATGCTCTCAAAAGTAAACTAAAA
GACCATTCTGATAACTAAAAAATTCTAGAAACACTAGAAAAATATACTGAAAAATATTTC
GGATTAGGAAAGAAGTTCAAAAAGGTGTATCGCGAAGAAAAGAAATAATATATCGACTGC
CATATCATTCATTTCTATAAGCTTTTCTATAAGATTAAAGTTTCATACTAGAATCAAGAA
TACAATATTTCATCTGTCTTGCTTGAAATGCAAGAAGCAGAATACATCTCATCAAATAAA
AAGAAATCAGCAGCATCTGAATTCTTTGCTAATTTCTAACCTGATGAGAAATAATCCTAT
TTCGATTTCTTATATTTAGTGTATCTCTGTACTAAAAAGTTTATGGATTAACACAAAAAT
CCTGGCTTGTACAATCAAGCTCATAAACTCTAGAAACCTGAAGATTTTGAAAAGGCAAAA
CCAATATTTAGCAGCATAATTAAATATTGCAATGATTTTGTTGAAAAAAATATTAGGAGC
GTGGATTCCTAATTTGAAAAGACCTTATTAGAAGCTAAACACAATGCCTAAGTTACAGAT
TAAGTTTGA


>TTHERM_00622800(gene)
ATGAGTTTTACTGTTGCTCGCGATGATAATAGGGACAAGCGTGGTTAAAATCAAACTGAA
GTTATGGAATAAAGACTTAAAAAATTATATCAGGATATTAGCATCCTTTAATCCAGAACA
GGAATCAAAAAGTAGCAAGTGAGCTAAAAAAATCTTGATTAGTTAATGTCTCTTTTAAAC
AAAAAGATATAGCAATATAGTTTTCCAGACACAATTATTGGATAAAACCACTACAAATTA
GTCTAAAAAGGCATGGATGCTCCTTCCCTTGAGCGTAAATTGCAGGAATAGAGATTTTTA
GCAGAAAAAGAATTGAGTAGTAAATCTAATTAAGAAAAGAGCCTATTTTGGATGGATATT
GTATTCTCAAAAGAAGGAATTGATACTTATTTAGAAAACAATCAAAACTATTTAATGTTT
AACTCTGTCGATACTATGAGAAGCCGTAACTCGAAAGGGGAAACTTTTGCTACTCGTTTG
CTTGCAAAAAAATCCTAACTTCGTGGTATTCTTGGTGATACTTATAGAGGAAATGTTGCA
GCATTAGCATCTGCACCAGGATTTAAGTACGATTAATTTCATCGCTTTGAGTAAGAGTCA
TCTTAAAATATTGATGATTATATTAAAGCTATGAGTTAATTTTAGTAAGGAAATTACACA
AAGTACTGTGATTATCTTGCAAAGAAATCAATTGATTATAAAGAGGTTTGGTAACTTTTA
GAGAAGATGGTTCCTACAGATGGATCAAACATATTTAAAATAAGTAAGAGATTGCAACGT
TTAAGAAAATCTGGGTAGTAGAATTAAAATTAATTACAATGCTTGTAAAATAATTTCAAT
TTGTAAAATGCTTATCATAATGGTATTTAGTATCTCCAATAAATTTACCGTAAAAATGCT
AAATAAAAAAAGCAAAACTTTTAGAGAATCTACGATGTTTATAATGTTGATTAGATCCGT
GGTTTTGATGATGATAATATCCCTATATGGTAAGAAATTTATCAGTTATTTAGAGCTGGT
GATTACGATGGTATTTTTAATCGCTGCCAATATTTCTCCAATGTAAGTGAAATTTAAGAG
TTTTAAAAAGATCTTGACATTTGGCTCAAAAGTGGATAACGTAAAAATAACTAACTAAGC
TAAAAAATACGTCCTAATTGGGATGCTTTCCGTTATCAAATATACCTCATTATGATAAAA
GACCCTTCTTGTGTCGACGACGTCTTTATTGAAGATTTAGATGACTGCCTATGGATGAAC
TTAAAATGCAGTGAAGTTTATGTTCCTCCTAACTAACAAGATCCTATTAATCCTATGAAC
ATCGAAGACGATATTGAAGATTAATACGAAGTACTTAATGGAAATAATCTCAGCACTAAC
GTATTAAATTAATCTGTTTAAGAGGATGAAAAAGATAATTTTTATGATACTGTTTTAAAA
GCAAGCTTAGACATTTCTCAAGATGAAATTCTTCCAGGAGAAGATGTTTACTCATGGATA
GACTGGAATTAGTTGCAAGACTTAAGGAAAATGCTTTATGAATCTTTCAAGGAATCTCCA
GATGTCTTTAATCCTTCTCGTGTTCTTATGATCTAATTGCTAACTCTAGATTTCATTGGT
TTTGTACAAACACTTTTACAATTAGAAAAAAGTGCTATCTCTCAACATGAATTCACTCAT
TTCTTAATTTTAATCTTAAAAACTGGTTTGGTGCGTGCTTCTGTTGAATGTTCTGTCAAA
TTTGCTGAATCTGGAAATTCATCCTATGGAGAAAGTAAGGACATTCTTGTAAGAAGATGC
AAGGAATTCGAAGAAAGCGCAGAGAAAAAAATAATTCTTTATGCTAAAGATAGATTTGAT
AATTATCCAGATACTTGTTTTTCTTATATTGAATCTCTTCCTATAAAAGTTGAGGATTAA
TTGAAAAAGTATGCAAATATCTATGTTGGATCTAAATAAAATTTTATCCATCTGTTTAAG
CCAAACCTTAATTTCTCTTAATAGCTTGATTCTAATTCAATGACTTCGAATAATAGTCAA
TCATAAAACAGAGGAAAAGTTTTTGACTAAATTTGTAAAATAAATAATCGTCTAAAAAAG
ATAACTTACACAACTAAGGCATAACTAAGAACAGGATAGAATGTTCAAAGCGAAAATTTA
CTTACACTTTTAGCCAAAATAGTAGCATAAACCTACATTCAAACATAGAATAAGGTAGAA
GTAGCTCTTGAAATTCTTGATAACGTAGGTGCCTTTGAAGATATTGGTAGAATATTGAAG
GAATAATTCCGCTTATGCACTTCTCTTTCATAGAATCATGCTCTCAAAAGTAAACTAAAA
GACCATTCTGATAACTAAAAAATTCTAGAAACACTAGAAAAATATACTGAAAAATATTTC
GGATTAGGAAAGAAGTTCAAAAAGGTGTATCGCGAAGAAAAGAAATAATATATCGACTGC
CATATCATTCATTTCTATAAGCTTTTCTATAAGATTAAAGTTTCATACTAGAATCAAGAA
TACAATATTTCATCTGTCTTGCTTGAAATGCAAGAAGCAGAATACATCTCATCAAATAAA
AAGAAATCAGCAGCATCTGAATTCTTTGCTAATTTCTAACCTGATGAGAAATAATCCTAT
TTCGATTTCTTATATTTAGTGTATCTCTGTACTAAAAAGTTTATGGATTAACACAAAAAT
CCTGGCTTGTACAATCAAGCTCATAAACTCTAGAAACCTGAAGATTTTGAAAAGGCAAAA
CCAATATTTAGCAGCATAATTAAATATTGCAATGATTTTGTTGAAAAAAATATTAGGAGC
GTGGATTCCTAATTTGAAAAGACCTTATTAGAAGCTAAACACAATGCCTAAGTTACAGAT
TAAGTTTGA


>TTHERM_00622800(protein)
MSFTVARDDNRDKRGQNQTEVMEQRLKKLYQDISILQSRTGIKKQQVSQKNLDQLMSLLN
KKIQQYSFPDTIIGQNHYKLVQKGMDAPSLERKLQEQRFLAEKELSSKSNQEKSLFWMDI
VFSKEGIDTYLENNQNYLMFNSVDTMRSRNSKGETFATRLLAKKSQLRGILGDTYRGNVA
ALASAPGFKYDQFHRFEQESSQNIDDYIKAMSQFQQGNYTKYCDYLAKKSIDYKEVWQLL
EKMVPTDGSNIFKISKRLQRLRKSGQQNQNQLQCLQNNFNLQNAYHNGIQYLQQIYRKNA
KQKKQNFQRIYDVYNVDQIRGFDDDNIPIWQEIYQLFRAGDYDGIFNRCQYFSNVSEIQE
FQKDLDIWLKSGQRKNNQLSQKIRPNWDAFRYQIYLIMIKDPSCVDDVFIEDLDDCLWMN
LKCSEVYVPPNQQDPINPMNIEDDIEDQYEVLNGNNLSTNVLNQSVQEDEKDNFYDTVLK
ASLDISQDEILPGEDVYSWIDWNQLQDLRKMLYESFKESPDVFNPSRVLMIQLLTLDFIG
FVQTLLQLEKSAISQHEFTHFLILILKTGLVRASVECSVKFAESGNSSYGESKDILVRRC
KEFEESAEKKIILYAKDRFDNYPDTCFSYIESLPIKVEDQLKKYANIYVGSKQNFIHLFK
PNLNFSQQLDSNSMTSNNSQSQNRGKVFDQICKINNRLKKITYTTKAQLRTGQNVQSENL
LTLLAKIVAQTYIQTQNKVEVALEILDNVGAFEDIGRILKEQFRLCTSLSQNHALKSKLK
DHSDNQKILETLEKYTEKYFGLGKKFKKVYREEKKQYIDCHIIHFYKLFYKIKVSYQNQE
YNISSVLLEMQEAEYISSNKKKSAASEFFANFQPDEKQSYFDFLYLVYLCTKKFMDQHKN
PGLYNQAHKLQKPEDFEKAKPIFSSIIKYCNDFVEKNIRSVDSQFEKTLLEAKHNAQVTD
QV