Identifiers and Description

Gene Model Identifier

TTHERM_00624310

Standard Name

DTD1 (D-Tyr-tRNA Deacylase 1)

Aliases

PreTt07419 | 87.m00199 | 3814.m00902

Description

DTD1 D-tyrosyl-tRNA(Tyr) deacylase; D-tyrosyl-tRNA (Tyr) deacylase

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_12013.1 6.000220702367707e-121
Description: D-tyrosyl-tRNA(Tyr) deacylase (353 aa)
Oxytricha Contig14211.0.g46 1.9991939848149086e-44
Description: D-Tyr-tRNA(Tyr) deacylase
WormBase WBGene00004151 3.000619078166531e-39
Description: locus:pqn-68 D-tyrosyl-tRNA(Tyr) deacylase status:Confirmed UniProt:Q9XUP4 protein_id:CAB04731.1
DictyBase DDB_G0291273 6.99868990988981e-32
Description: dtd on chromosome: 6 position 40029 to 40659
SGD YDL219W 4.9988726541653934e-26
Description: DTD1 D-Tyr-tRNA(Tyr) deacylase, functions in protein translation, may affect nonsense suppression via alteration of the protein synthesis machinery; ubiquitous among eukaryotes
Stentor Coeruleus SteCoe_9144 2.3195228302435696e-16
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00624310(coding)
ATGAGACTCATCATTTAAAGAGTTTTAGAAGCAGGAGTTAAAGTTAATGGCGAATTCATC
TCCAAAATAGGTCCAGGAATTTGTATTTTGTTAGGTTTACATAGAGGTGATAATGCTGAG
TTAGTTGATAAATGGGCTGAAAAAGCTTTGAAATTAAAATTATGGCCTGATATGGAAAAT
TAATCTGAAGAACAAAAAGAGAGCAACAATCCTAAGGGAAAAGGAGGTTGGAAGACAGGT
GTATAAGATAACAATTATGAAGTTTTGGTTGTTTCTAACTTTACTTTATATGGAGTTTTG
AAAGGAAATAAGCCTGATTTTCATGATTCTATGAATGCAGATGAAGCTAGGGACCTTTAC
AATAGATTTATGGAGAAGATGTAGTAACATTACAAAAAAGAAAAAGTTCAAGGAGGATAA
TTTTAGACATATATGAATGTTCATATTGTTAATGATGGACCTGTCACTTTATGTATTGAT
GCTGATGAAGTTAATAACATGAAACAAAACTAATAAAAACAAAAAGAAACATAATAGTAA
AATGAGAAAATAAATAGCGAAGGCAATAAAGTTGAAGGTGAAATAAAGGAAAAGTAAGAA
AAAAAATAAAAGAATAACTCTGAATAAAAGAATAAATAGCATGGAGGAGAAAAATAACAA
AAACCTCAAGGAGAAAATAAGTAAAACGCTTAAGGAGAACATAAGCAAAAAAATTAGGGA
GAAAACAAATAGAAGCAACAAGGAGAATAAAAGTAAAAAAATTAATAGAATGACCAAAAA
CAAAAACCCTAAGCTGAACAAAAATAGAAAGCTTAGTAAACTGAGATTGCTTAAAAAAAA
TAAAAGCCAATTTATGAAGAAAAAGTTGATGATAATTCTGCAAAAGTAGAATAAAAGGAC
GCTTAAGAAAACTAATAATAAGAATGA


>TTHERM_00624310(gene)
ATGAGACTCATCATTTAAAGAGTTTTAGAAGCAGGAGTTAAAGTTAATGGCGAATTCATC
TCCAAAATAGGTCCAGGAATTTGTATTTTGTTAGGTTTACATAGAGGTGATAATGCTGAG
TTAGTTGATAAATGGGCTGAAAAAGCTTTGAAATTAAAATTATGGCCTGATATGGAAAAT
TAATCTGAAGAACAAAAAGAGAGCAACAATCCTAAGGGAAAAGGAGGTTGGAAGACAGGT
GTATAAGATAACAATTATGAAGTTTTGGTTGTTTCTAACTTTACTTTATATGGAGTTTTG
AAAGGAAATAAGCCTGATTTTCATGATTCTATGAATGCAGATGAAGCTAGGGACCTTTAC
AATAGATTTATGGAGAAGATGTAGTAACATTACAAAAAAGAAAAAGTTCAAGGAGGATAA
TTTTAGACATATATGAATGTTCATATTGTTAATGATGGACCTGTCACTTTATGTATTGAT
GCTGATGAAGTTAATAACATGAAACAAAACTAATAAAAACAAAAAGAAACATAATAGTAA
AATGAGAAAATAAATAGCGAAGGCAATAAAGTTGAAGGTGAAATAAAGGAAAAGTAAGAA
AAAAAATAAAAGAATAACTCTGAATAAAAGAATAAATAGCATGGAGGAGAAAAATAACAA
AAACCTCAAGGAGAAAATAAGTAAAACGCTTAAGGAGAACATAAGCAAAAAAATTAGGGA
GAAAACAAATAGAAGCAACAAGGAGAATAAAAGTAAAAAAATTAATAGAATGACCAAAAA
CAAAAACCCTAAGCTGAACAAAAATAGAAAGCTTAGTAAACTGAGATTGCTTAAAAAAAA
TAAAAGCCAATTTATGAAGAAAAAGTTGATGATAATTCTGCAAAAGTAGAATAAAAGGAC
GCTTAAGAAAACTAATAATAAGAATGA


>TTHERM_00624310(protein)
MRLIIQRVLEAGVKVNGEFISKIGPGICILLGLHRGDNAELVDKWAEKALKLKLWPDMEN
QSEEQKESNNPKGKGGWKTGVQDNNYEVLVVSNFTLYGVLKGNKPDFHDSMNADEARDLY
NRFMEKMQQHYKKEKVQGGQFQTYMNVHIVNDGPVTLCIDADEVNNMKQNQQKQKETQQQ
NEKINSEGNKVEGEIKEKQEKKQKNNSEQKNKQHGGEKQQKPQGENKQNAQGEHKQKNQG
ENKQKQQGEQKQKNQQNDQKQKPQAEQKQKAQQTEIAQKKQKPIYEEKVDDNSAKVEQKD
AQENQQQE