Identifiers and Description

Gene Model Identifier

TTHERM_00628440

Standard Name

NRK34 (NIMA-Related Kinase )

Aliases

PreTt24670 | 88.m00138 | 3822.m00659

Description

NRK34 plant dual-specificity MAP kinase kinase family domain protein; NIMA-Related Kinase

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_17279.1 9.997093137033517e-262
Description: protein kinase domain-containing protein (760 aa)
Oxytricha Contig1689.0.g14 1.0004982362389172e-141
Description: Protein kinase domain
DictyBase DDB_G0275241 3.999244945363787e-60
Description: nek3 on chromosome: 2 position 4983790 to 4987279
Stentor Coeruleus SteCoe_34801 4.7111658015535965e-58
Description: None
WormBase WBGene00008956 1.9998745702418095e-48
Description: locus:nekl-3 status:Confirmed UniProt:G5EFM9 protein_id:CAA92169.2
SGD YAR018C 2.999884853455273e-42
Description: KIN3 Nonessential serine/threonine protein kinase; possible role in DNA damage response

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16611747: Wloga D, Camba A, Rogowski K, Manning G, Jerka-Dziadosz M, Gaertig J (2006) Members of the NIMA-related kinase family promote disassembly of cilia by multiple mechanisms. Molecular biology of the cell 17(6):2799-810

Sequences

>TTHERM_00628440(coding)
ATGTCTTTAAAAGATTTTTAAATAGTCTAAAAGCTAGGCGAGGGAGCTTATAGCAGCGTT
TATAAAGTAAAGAGGTATGGTGATGGCCAAGAATATGCTCTCAAAAAGGTGAAACTATAA
AATTTAAGTGAAAAAGAAAAATAAAATGCCTTAAATGAAGTTAGAATACTTGCCTCAATT
CGCGCAAATAATATTGTTGGATATAAAGAGGCCTTTTTAGACGAAATGTCTAATTCTCTA
TGTATCATTATGGAATATGCTAATAATGGCGATCTTTTTCAAAAAATAGTTGACCATTAA
AAGAAAGGCCAGCTATTCCCTGAGTAGGAGATATGGAACATCTTTATACAAATGGTGAAG
GGCATCAAATCTTTACATGATTTGAAAATTTTTCACCGTGATCTGAAGAGTGCCAATGTG
TTTTTGAATAAAGATGGCACAGTCAAATTAGGTGACATGAATGTTTCAAAAGTTGCCAAA
AAGGGTTTACTCTATACTCAAACAGGAACACCTTACTATGCAAGTCCAGAAGTATGGAAA
GATTAGCCCTATGATGCAAAATCTGATATTTGGTCACTCGGTTGTGTCTTATACGAGATG
ACTACACTCAAACCACCCTTTAGAGCAGAAGATATGGAGGGTTTATACAAAAAAGTTATA
AGAGGATACTATCCTAGAATTCCTCCTCATTTCTCATAAGACCTTGCTAATGTTATCAGA
GCACTGCTTTAAGTAGCTCCTCACTTAAGGCCATCAGCAGACAAGATACTTTAGTTACCA
GCTGTCATCAAAAGAGTAAATGATAGCCACCTCCTTGAAGTTGATGAAGGAGTTCCCTTC
TTGTTGACAACAATCAGAGTTCCTAAAAATTTACATTACCTTACGGATAGGCTTCCTAAA
CCTAACTATGCCCCATTAAAAATGAAAAAAATTGAAAAGTAAAGGTTTTTATAAACCTTA
GCTGGTTACAGAGGTGAAAGAAACGCCAGTCCAATGGATGACGATGAATAATCTTAAGCT
AGTTAAATCATAACTTAAACTCAAACACAGTAATAAGAAAAAGGTTAGCAGTAAATACTT
CATCTTCCCAAAATAAATCCTAAGGTACAAAAGAATCTACCTTCTGCTTAGGCAGCTCCA
ACGTAGGATACTGGGTCACATAACAATAGCCAGCTTATAAGTAATAACAATAATAATGGT
AGCAGTAACTATATAGGTTCAAACCATAAAGATAAGGATAGTGATGCTAATTCGATTAAC
CAGTCAATAATTAACGATCACAATAGCATCAAAAAGAAGAAAAAGAAATAACCTGAATAC
GATTAAAATTCTTCTGTAGTTAGTGCTACAAACATTAATAAAGATATAAGTTTACTAATT
TCTTCACCATAAAATGCAGGAGCAAACCAATAAAACAAACCATAAAAGAAGGATTACAAT
GATAAATAAAAGTATGAAGTCCTTGAAGTTATAAGACAAATAAAATACTATGATTATCCA
TAGTAAGGAGCCCCAAAAGGATCAAAATAGTACCAATAAAGCTCTTAAGGCTCCATATAA
AGTTTGGCACAAGTTCAAGGTTAAAGTGTACATCAACATCAAGCACAATATGATTCCCTT
TCCCCAAACAGAAGAAAAAAGAATGATAACTTAAATCTTTTAGACATAGAAGGTGAGTCA
AAACCCCTCTTAAAAAAGAATCGTAAAAATCCTTCAATCCACAATTCTCCAAATAATAAA
TATGATGATATTTCTGTGAGCTCAAAAAATCCAGTTTTAGAAGAAAGTAATAAATTACCA
TCAATTGGCATTACAAAACTTCCAAAGATATAAGGATTAGCCGGTAATCAAGGAATTGAT
AGTAAATTATTAGCAATATAGTAACCTAAAATTGTAAATGACAAAGAAAACTAGAAGATA
AGAGAGATTTCTAGAGCTTATAAAGTGAATATAAATTAACTAGATGATATAAAAGACAGG
TACAGATCTATTAAAAGAATGGAGTAATCTAAGAGTAAACAATATGTGTTGAAGAATTCT
AGTCTTCCTAGCAGTAATTAATAATAATTAGAAATAGGAGGTAACTAAAAATACTATAAT
TATTCTCTCGTTGATCCCTCAAGTGGATAACATTCAAAAAACAAGTGA


>TTHERM_00628440(gene)
ATGTCTTTAAAAGATTTTTAAATAGTCTAAAAGCTAGGTAAAGATAAATCAAAACAATTT
AATAGATTTTACAATTGACTTCCATAATTAAAAATAAGGCGAGGGAGCTTATAGCAGCGT
TTATAAAGTAAAGAGGTATGGTGATGGCCAAGAATATGCTCTCAAAAAGGTGAAACTATA
AAATTTAAGTGAAAAAGAAAAATAAAATGCCTTAAATGAAGTTAGAATACTTGCCTCAAT
TCGCGCAAATAATATTGTTGGATATAAAGAGGCCTTTTTAGACGAAATGTCTAATTCTCT
ATGGTAAACACTTAAACCTCTTTCATCATGATCTATATTTTTAATAAACATTATCTTTTA
AATGCTCTGCAGATATTTAAATAATCAATTTTATAAACTCATAAAATGAGCTATTGTCAT
AGCTTGAAAGTTATTCAAGATTAACTGCAAAGAATTTTTTAGGATGAGTATATGTTTAGA
ATTTAAGAATTACTTTTTGTATTAATAGTATCATTATGGAATATGCTAATAATGGCGATC
TTTTTCAAAAAATAGTTGACCATTAAAAGAAAGGCCAGCTATTCCCTGAGTAGGAGATAT
GGAACATCTTTATACAAGTATTAAAACGTTATTTAAAAAAAAAGACTTTCAATCAATATA
TTAATTTTCATTTATTTAAAAGATGGTGAAGGGCATCAAATCTTTACATGATTTGAAAAT
TTTTCACCGTGATCTGAAGGTAATTTATTAATTAATTAATGCTCATATTTAAGATTTGAT
CCAAATTATCATAACTCCTTTCAAATCAATTTATCAGAATAATTAAATTATTGGTGATGC
ATATAATTAATACTGACTTGCTTGTTTCTTACCAAAATCTAATTATAGATAGCAAAAAAA
TAATAAATTTAATAAAAAGCAACTTCCATCTATCATTTATTTTTTTATTTATTTGCTTAT
CCTGCTAAACTGATAAATCAATCAGCTATTAAAATATTTAATTTATCTTAAGTTATTTCA
TATGTTTTATTTTATAAAATTAAGAGTGCCAATGTGTTTTTGAATAAAGATGGCACAGTC
AAATTAGGTGACATGAATGTTTCAAAAGTTGCCAAAAAGGGTTTACTCTATACTCAAACA
GGAACACCTTACTATGCAAGGTATTTCATTTAAAATTAAAAAGAAATCTTTATTTATATA
TCTAATAAAGTCCAGAAGTATGGAAAGATTAGCCCTATGATGCAAAATCTGATATTTGGT
CACTCGGTTGTGTCTTATACGAGATGACTACACTCAAACCACCCTTTAGAGCAGAAGATA
TGGAGGGTTTATACAAAAAAGTTATAAGAGGATACTATCCTAGAATTCCTCCTCATTTCT
CATAAGACCTTGCTAATGTTATCAGAGCACTGCTTTAAGTAGCTCCTCACTTAAGGCCAT
CAGCAGGTATTTTAAACCATAATTAATTCATATTTGTATACTCATAGATCATCAAAAATA
AAAAAAATATTTTTTGTCATTTTTATTAAACAAAATAACATTTTTCAAAGAGAAAATATT
TAAAATAATAATAAATTTTTGAAAAAGTTTAGATAAGCAATTTTTGGCCAGTTAAATTTT
AAAAAATAAAGATTTTCAATTAATTAATTACAAGTTTTTAATAGAAATATTTAATAAACT
GATTAGACGATTAATTTTATCAATTAAACTAATTATATTTATTTTTAAATGATTTTAGAC
AAGATACTTTAGTTACCAGCTGTCATCAAAAGAGTAAATGATAGCCACCTCCTTGAAGTT
GATGAAGGAGTTCCCTTCTTGTTGACAACAATCAGAGTTCCTAAAAATTTACATTACCTT
ACGGATAGGCTTCCTAAACCTAACTATGCCCCATTAAAAATGAAAAAAATTGAAAAGTAA
AGGTTTTTATAAACCTTAGCTGGTTACAGAGGTGAAAGAAACGCCAGTCCAATGGATGAC
GATGAATAATCTTAAGCTAGTTAAATCATAACTTAAACTCAAACACAGTAATAAGAAAAA
GGTTAGCAGTAAATACTTCATCTTCCCAAAATAAATCCTAAGGTACAAAAGAATCTACCT
TCTGCTTAGGCAGCTCCAACGTAGGATACTGGGTCACATAACAATAGCCAGCTTATAAGT
AATAACAATAATAATGGTAGCAGTAACTATATAGGTTCAAACCATAAAGATAAGGATAGT
GATGCTAATTCGATTAACCAGTCAATAATTAACGATCACAATAGCATCAAAAAGAAGAAA
AAGAAATAACCTGAATACGATTAAAATTCTTCTGTAGTTAGTGCTACAAACATTAATAAA
GATATAAGTTTACTAATTTCTTCACCATAAAATGCAGGAGCAAACCAATAAAACAAACCA
TAAAAGAAGGATTACAATGATAAAGTAAATTAATTTATTATTATTTTTATAAAACAAATA
TAAAAATCTTATTTAATTAATTTAGTAAAAGTATGAAGTCCTTGAAGTTATAAGACAAAT
AAAATACTATGATTATCCATAGTAAGGAGCCCCAAAAGGATCAAAATAGTACCAATAAAG
CTCTTAAGGCTCCATATAAAGTTTGGCACAAGTTCAAGGTTAAAGTGTACATCAACATCA
AGCACAATATGATTCCCTTTCCCCAAACAGAAGAAAAAAGAATGATAACTTAAATCTTTT
AGACATAGAAGGTGAGTCAAAACCCCTCTTAAAAAAGAATCGTAAAAATCCTTCAATCCA
CAATTCTCCAAATAATAAATATGATGATATTTCTGTGAGGTAATCTTAATAAAAAAATAT
AAAAATTAAAATTTATAAATTGATATTTAAAAAAAAAATGATTCTAATTAATTTAATTAT
AAAAAGCTCAAAAAATCCAGTTTTAGAAGAAAGTAATAAATTACCATCAATTGGCATTAC
AAAACTTCCAAAGATATAAGGATTAGCCGGTAATCAAGGAATTGATAGTAAATTATTAGC
AATATAGTAACCTAAAATTGTAAATGACAAAGAAAACTAGAAGATAAGAGAGATTTCTAG
AGCTTATAAAGTGAATATAAATTAACTAGATGATATAAAAGACAGGTACAGATCTATTAA
AAGAATGGAGTAATCTAAGAGTAAACAATATGTGTTGAAGAATTCTAGTCTTCCTAGCAG
TAATTAATAATAATTAGAAATAGGAGGTAACTAAAAATACTATAATTATTCTCTCGTTGA
TCCCTCAAGTGGATAACATTCAAAAAACAAGTGA


>TTHERM_00628440(protein)
MSLKDFQIVQKLGEGAYSSVYKVKRYGDGQEYALKKVKLQNLSEKEKQNALNEVRILASI
RANNIVGYKEAFLDEMSNSLCIIMEYANNGDLFQKIVDHQKKGQLFPEQEIWNIFIQMVK
GIKSLHDLKIFHRDLKSANVFLNKDGTVKLGDMNVSKVAKKGLLYTQTGTPYYASPEVWK
DQPYDAKSDIWSLGCVLYEMTTLKPPFRAEDMEGLYKKVIRGYYPRIPPHFSQDLANVIR
ALLQVAPHLRPSADKILQLPAVIKRVNDSHLLEVDEGVPFLLTTIRVPKNLHYLTDRLPK
PNYAPLKMKKIEKQRFLQTLAGYRGERNASPMDDDEQSQASQIITQTQTQQQEKGQQQIL
HLPKINPKVQKNLPSAQAAPTQDTGSHNNSQLISNNNNNGSSNYIGSNHKDKDSDANSIN
QSIINDHNSIKKKKKKQPEYDQNSSVVSATNINKDISLLISSPQNAGANQQNKPQKKDYN
DKQKYEVLEVIRQIKYYDYPQQGAPKGSKQYQQSSQGSIQSLAQVQGQSVHQHQAQYDSL
SPNRRKKNDNLNLLDIEGESKPLLKKNRKNPSIHNSPNNKYDDISVSSKNPVLEESNKLP
SIGITKLPKIQGLAGNQGIDSKLLAIQQPKIVNDKENQKIREISRAYKVNINQLDDIKDR
YRSIKRMEQSKSKQYVLKNSSLPSSNQQQLEIGGNQKYYNYSLVDPSSGQHSKNK