Identifiers and Description

Gene Model Identifier

TTHERM_00628520

Standard Name

DRH31 (DExD/H box RNA helicase 31)

Aliases

PreTt24678 | 88.m00146 | 3822.m00666

Description

DRH31 DEAD/DEAH-box helicase family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_17275.1 9.997093137033517e-262
Description: DEAD/DEAH box helicase (1412 aa)
SGD YLR398C 1.999126889527329e-167
Description: SKI2 Ski complex component and putative RNA helicase, mediates 3-5 RNA degradation by the cytoplasmic exosome; null mutants have superkiller phenotype of increased viral dsRNAs and are synthetic lethal with mutations in 5-3 mRNA decay
Oxytricha Contig21835.0.g97 1.999765224767555e-159
Description: DSHCT (NUC185) domain
WormBase WBGene00008502 4.0008150871967356e-141
Description: locus:skih-2 status:Partially_confirmed UniProt:Q19103 protein_id:CAA92767.2
DictyBase DDB_G0275633 8.001645293484705e-131
Description: DDB_G0275633 on chromosome: 2 position 5972320 to 5975825
Stentor Coeruleus SteCoe_7917 5.814040485895939e-62
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00628520(coding)
ATGAATGGATAAGAAGATTAACTACTTTAGGCATTTGACTGGTTAATATATGCTAACTAA
AGCAGAATTCCAAAAATATTAGATTTTGAATAACAGTTATTTTAGTTCGATGTGAAAGAC
CAAGCTCTCCCTAGTCATTTTTAGGTTGTGATTAATAATCCAGAAAGATAAAATACATAA
TTATATCTCAATAATCATTTCACTAGCGTTCACTATGAAGAATCTTTTGCAGATTTAAAA
TATATTAAAAAAGGGTAATTAGAACGAAGAATTTTAAAAGATATTTATGAGCATGATGTA
GATTTAATGGGTTTTTAATTCGATTAAAATTAAGTTGAATCTGAAATGTTAGATATAGGC
TATAAGCGCGCATTAGATGAAGTAGATTTACACTTAAAAAATCCTTTTACAACAACTTTT
AGCTATGATTATATGGATAACGAATTTACAGGATTTTAAGACTAAATGGTGTAGAATAAT
TCATTTAAGAATTATTCAACAGATCAATCTTAAGATAATACACAACAACAATAAAAAGGC
TAGTAATTATTAAACGAATATTACAATCAAGGTAATGCAAGCTAAGAAATAAATGCTTAA
TAAGTTTAAGGTTATTAATCGCAAAATAATATAGTTGAGGACTTTTAAGTCTTGGGAAAT
CAGGTAGAATAATACTTAGCTGAACTAAGATAAAAATAGCAAAGCATTAAAAATAGAATT
AATATTCCTTAGCTTTCACTAGAAGATCTCATTAAAGTGAATAAATTTAGCAGAGTCCTT
TCTATTTTCTAAAAAGCAGGTTAAAAAGAAGCAAAAAAGCACAAAGTTATTTAAAAATCT
ACTGTAGACATGGACCCAGAAGAGATTTTCAAACAATTAAAAAGTGAGTGGGTAGAAGAA
TAAAAAGAAGAGGAAGAATTAAAATAATCTTATGAGCTGTAAATTTTAGCAAATTTAGAT
TTTGATGTTATGATAGACAAAGTAGAAGAAAAAATACAATTTGAGGAATAGCAACTACTT
GAAAAGGTCAAAAAGATGTAGGAAGAATTAAAATCTCAAAGCTTCGAGATGCAAGAAGAC
CAAATTTATTCTCTAGGATAGCAAAATAAAATGGAATAATTTAATAAAATTAAATTGGTG
GATACTTAAGAAATCAATGAAAAAAAATTATAATTGTCTTCATCTTACGATTGGGCAGTC
GAAGATCAGTTTAATTTAGCTAAATTTTATGAGGAAGTACCCAAAGAAAAAATGGCGTAA
TAATATCCTTTTGAGCTCGATGCTTTCCAAAAGAGGTCAGTTTACAGAATAGAAAGAAAA
GAAAGTGTTTTTGTTTGTGCTCATACATCTGCAGGTAAAACAGTAGTTGCTGAATACGCA
ATAGCTATTTCTAAAAAGCTTAATAGAAAAGCAATTTATACTTCTCCTATTAAAGCTTTA
TCAAACCAAAAGTATAGAGATTTTAAGTAAAAATACGGTGATGATGTAGGTCTAGTTACT
GGTGATGTGTAACTCAACCCCAATGCAAATTGTTTAATTGTAACAACAGAAATTTTGAGA
AATATGCTCTACAGAAACAACGATATAATTAGAGATATTGAATGGGTTATATTTGATGAA
GTTCATTATTTAAATAATCCTGAGAGAGGTCTGGTTTGGGAAGAAACAATTATTATGCTT
CCTGAGACAGTCGGTTTTGTAATGCTCAGTGCAACAGTTCCGAATTACATGGAATTCGCT
AATTGGGTAGGAAGAACTAAAAAAAGAAAAATTTATGTATAAAAAACTGATTTTAGACCT
GTTCCCTTAGAACATTCTATTTATTTAAATGGCTCAATAGAAGTAATTAAGCAAGGAGAC
AATCGTTTTAATGCCACTGATTATGACTAATTTAAGAACAGAATTATAAAAACATACATG
AATCAGAAGAATTAATTAACTGCATAAAAGAAATCATTAAAGCTTGAAAAGTATCAAAAA
GGAATTCTAAAAAATACAAATACATCGATGAGAAACAAAAGAACAATGAAAGCAATCACT
GAAAAATTCATTAAATCCACTGATGAAGACGATTACAATTCTTCAAGCAGTACAAACGAA
GGATTTAATTTGATGTAACTCCTAATTAAATGCTAAAATGAAAACTTACTACCCTGTGTT
ATTTTCTGCTTTTCTAAAAGGAAAATAGACGAAATAGCAAATTAAATTAAATAACTTAAC
TTTTGTGATTATGAGGAAACTGTAAGAATAGAATATTATTTCAGGTAGTGTTCCAGAAAG
ATTAAGTCAAGAGATTTAAATGTGCCTTAAATACAAACCATTAAAGATTTACTTCTTAGA
GGTATAGGTATCCATCATGGTGATGTTATTCCTTTCATGAAAGAAGTTGTTGAAATTCTT
TTCTCACAAAGCCTTATAAAAGTTCTAATTGCTACAGAAACATTTGCTATGGGTATTAAT
ATGCCTACAAAAACAGTTATTTTCCACTCTCTTAAAAAGTTTGACTCTTCTGGTGAAAGA
CTGCTGAATTCATCAGAATTTACTTAAATGAGTGGTAGAGCAGGTAGAAGAGGTTTAGAT
GTAAAGGGAAATGTTATAATTTTTGTTAATTCAATTGAGTAGCTTCCATCTAAAAATGAC
TTAAATATCATAATGGACACTAAGGGATAATATTTGGAATCTAAATTTAAAATCACATAT
GAAACAATCATCAACTTGCTTAATTCTAATGTACTTAATGTAATTGATATGATGAAGAAA
AGTTATTAAGAGAATCACAAATATGCTTAGTTACCAAACAATATCAAGAAAATAAAAGAA
CTTAAATTAAAATATTTAGAATTAAAGAATATGAAATGCAAATTACAACCTCCAGGAATC
GATGAACTTCCTATTGAGAAATACATATAAAGTTCTTAAATTATGAGATAATTAAATAAA
AACTATTTCTAACAAGTAAAAACATACATGGTAGAAAAGATGGAGCTTCCTTCTTACTGT
GTCATGTACGATGACGTTTACAAATTCTATTTTGGGATGATTATTTATATCAATCTTAAA
GATAAATACGAAGACAGATTCCTATATGTTTTATATGTAGATAGTATTGATGTCCAACAA
GGACCTATTTTTAATTTCCAAGAAGATGCATTCCACTCACATGTTGTCGAAAATCACCAT
TACTGTGATGAATCTAACGACTACAAAGAATATACTTACAAAATATTTAAGCTGCCCGTT
TCTTGCATTTGTAAGATATACGAAGATGACCCTGGAATTGAAGATGGAGAATTAGAAGAT
TAAGAATATGTTTAATCATGCGTTAAGTTGCTTATTTCTAAAAAAAATTAATTTAAAGAG
GTTTTTCTATCTGAAGAAATCTCATCTAAAAAAATGAAGAGGAAAAAATTCTTGGATATG
AAATTCTAAAACACAACTGACATATCAAAATCTGCACTAAATAATAATTTAGACTCAATA
TAAACTTCACTTTGTCATTAATGTGATATCAAAGATTTGCATATTAGCCAAGTCTTCGAA
AGAAAGTAAATTAAAACTGATCTAGAAGAACTTATTAAAAAAGTAGATGAAAATGACTTA
AATCAAAGAACAAGTTTTGAAAGTAAATTGAAGATTTTGAAAAGATTTGGTTATGTTGAT
TTAGTTAACAAACCTACTTTTAAGGCTCGTATAGCTAAAGAAATACAAAATATTTATGTC
ACAGAGGTAATATTCTAAGAATCTCTTGAATCTTTAGAAGAATGTGACATAGCAGCTCTT
CTAAGTGGTTTTGTATGTTAAGCTAAATCTAAAAGTGCAGTTAAATATGACCCAATAGAT
GACTTTAGCCCTTTCTATCCTAATTATGATAATTTTATGGAATCTTATCTAGAAATTATA
TAATCTGTCAAGGCTGTTATCTCTTACGAATGTTAATTCGGAGTTATTCAATGTGGTAAT
GAAGATGACTATATGTTTGATCAAGTTTATATAAGAGACTTAATTGAAGTTGTATACTAA
TGGATGAATGGAATGGATTTCTAAAATATTTGCGAAATGACATCTATATAAGAAGGTGCT
ATAGTAAGAAGCTTCCTTAGACTTGAAAATTTACTCAAAAATGTAAGAAATGGTTATATT
ATTATGGGAAATTATGCAATGGGAGTTAAACTAGACAGATGCATGGAAATGCTCAAGAAA
GATATAATTTTTTCTAAAAGTTTGTATTTAGACTAAGACGATCATTGA


>TTHERM_00628520(gene)
ATGAATGGATAAGAAGATTAACTACTTTAGGCATTTGACTGGTTAATATATGCTAACTAA
AGCAGAATTCCAAAAATATTAGATTTTGAATAACAGTTATTTTAGTTCGATGTGAAAGAC
CAAGCTCTCCCTAGTCATTTTTAGGTTGTGATTAATAATCCAGAAAGATAAAATACATAA
TTATATCTCAATAATCATTTCACTAGCGTTCACTATGAAGAATCTTTTGCAGATTTAAAA
TATATTAAAGTAATTTATTCAATTTATCAAAATTTAATGTTAAATGTTCAATATTTTTTT
ATAGAAAGGGTAATTAGAACGAAGAATTTTAAAAGATATTTATGAGCATGATGTAGATTT
AATGGGTTTTTAATTCGATTAAAATTAAGTTGAATCTGAAATGTTAGATATAGGCTATAA
GCGCGCATTAGATGAAGTAGATTTACACTTAAAAAATCCTTTTACAACAACTTTTAGCTA
TGATTATATGGATAACGAATTTACAGGATTTTAAGACTAAATGGTGTAGAATAATTCATT
TAAGAATTATTCAACAGATCAATCTTAAGATAATACACAACAACAATAAAAAGGCTAGTA
ATTATTAAACGAATATTACAATCAAGGTAATGCAAGCTAAGAAATAAATGCTTAATAAGT
TTAAGGTTATTAATCGCAAAATAATATAGTTGAGGACTTTTAAGTCTTGGGAAATCAGGT
AGAATAATACTTAGCTGAACTAAGATAAAAATAGCAAAGCATTAAAAATAGAATTAATAT
TCCTTAGCTTTCACTAGAAGATCTCATTAAAGTGAATAAATTTAGCAGAGTCCTTTCTAT
TTTCTAAAAAGCAGGTTAAAAAGAAGCAAAAAAGCACAAAGTTATTTAAAAATCTACTGT
AGACATGGACCCAGAAGAGATTTTCAAACAATTAAAAAGTGAGTGGGTAGAAGAATAAAA
AGAAGAGGAAGAATTAAAATAATCTTATGAGCTGTAAATTTTAGCAAATTTAGATTTTGA
TGTTATGATAGACAAAGTAGAAGAAAAAATACAATTTGAGGAATAGCAACTACTTGAAAA
GGTCAAAAAGATGTAGGAAGAATTAAAATCTCAAAGCTTCGAGATGCAAGAAGACCAAAT
TTATTCTCTAGGATAGCAAAATAAAATGGAATAATTTAATAAAATTAAGTAAAATCTATA
AAATATTTTTTTCATTTTCATTAAATTAAAAAATAAGATTTATTTAAATGCAAATTTAAA
TGAAATATTTTAAAAATAGATTGGTGGATACTTAAGAAATCAATGAAAAAAAATTATAAT
TGTCTTCATCTTACGATTGGGCAGTCGAAGATCAGTTTAATTTAGCTAAATTTTATGAGG
AAGTACCCAAAGAAAAAATGGCGTAATAATATCCTTTTGAGCTCGATGCTTTCCAAAAGA
GGTCAGTTTACAGAATAGAAAGAAAAGAAAGTGTTTTTGTTTGTGCTCATACATCTGCAG
GTAAAACAGTAGTTGCTGAATACGCAATAGCTATTTCTAAAAAGCTTAATAGAAAAGCAA
TTTATACTTCTCCTATTAAAGCTTTATCAAACCAAAAGTATAGAGATTTTAAGTAAAAAT
ACGGTGATGATGTAGGTCTAGTTACTGGTGATGTGTAACTCAACCCCAATGCAAATTGTT
TAATTGTAACAACAGAAATTTTGAGAAATATGCTCTACAGAAACAACGATATAATTAGAG
ATATTGAATGGTAAACAATTTATTTATTTTTCTTAAACGTTATGTTTTCATTGTTTATTT
ACAAAACACTGTCATTATTTCATTAAATTTAGTTAGCTAATAATTATATTTTTATATTTT
ATAGGGTTATATTTGATGAAGTTCATTATTTAAATAATCCTGAGAGAGGTCTGGTTTGGG
AAGAAACAATTATTATGCTTCCTGAGACAGTCGGTTTTGTAATGCTCAGTGCAACAGTTC
CGAATTACATGGAATTCGCTAATTGGGTAGGAAGAACTAAAAAAAGAAAAATTTATGTAT
AAAAAACTGATTTTAGACCTGTTCCCTTAGAACATTCTATTTATTTAAATGGCTCAATAG
AAGTAATTAAGCAAGGAGACAATCGTTTTAATGCCACTGATTATGACTAATTTAAGAACA
GAATTATAAAAACATACATGAATCAGAAGAATTAATTAACTGCATAAAAGAAATCATTAA
AGCTTGAAAAGTATCAAAAAGGAATTCTAAAAAATACAAATACATCGATGAGAAACAAAA
GAACAATGAAAGCAATCACTGAAAAATTCATTAAATCCACTGATGAAGACGATTACAATT
CTTCAAGCAGTACAAACGAAGGATTTAATTTGATGTAACTCCTAATTAAATGCTAAAATG
AAAACTTACTACCCTGTGTTATTTTCTGCTTTTCTAAAAGGAAAATAGACGAAATAGCAA
ATTAAATTAAATAACTTAACTTTTGTGATTATGAGGAAACTGTAAATAAATATCAATTAA
TTTAAAGCAACTTTTTTAGATTATTTTATATAAAAATAATTAAAGGTAAGAATAGAATAT
TATTTCAGGTAGTGTTCCAGAAAGATTAAGTCAAGAGATTTAAATGTGCCTTAAATACAA
ACCATTAAAGATTTACTTCTTAGAGGTATAGGTATCCATCATGGTGATGTTATTCCTTTC
ATGAAAGAAGTTGTTGAAATTCTTTTCTCACAAAGCCTTATAAAAGTTCTAATTGCTACA
GAAACATTTGCTATGGGTATTAATATGCCTACAAAAACAGGTAAAGACTTTACTAACTTC
ATTTCAAAATTTATTTATTTTTTTAATTTAAAAATTTCATTTTATTTTCTTAAAACTGGA
TTAATTTTTAAAATAAATAAACTCAGAAAAAAAGTTTAATATCAATTTTTTTGTTATTCA
AAGAAATATTTTTTATTTTCATATTTTAAGATCAAATTGTAAGTGAATAAATAATTTCAG
ATTAAATAAATTTATTTGTTTTATGTTTTGCTAAATATTTTTTTTCTTTAAATTTTGGAT
GGATTGAAAAAAAAATTCAAATTTAAAAAATAACTAAAAATATTTGTTAATTTTAATTAA
AAGTTATTTTCCACTCTCTTAAAAAGTTTGACTCTTCTGGTGAAAGACTGCTGAATTCAT
CAGAATTTACTTAAATGAGTGGTAGAGCAGGTAGAAGAGGTTTAGATGTAAAGGGAAATG
TTATAATTTTTGTTAATTCAATTGAGTAGCTTCCATCTAAAAATGACTTAAATATCATAA
TGGACACTAAGGTAAATAAATAAATAATTAGTATTCGATTAATATTAAATTTAAATAATA
TTTTTTATAGGGATAATATTTGGAATCTAAATTTAAAATCACATATGAAACAATCATCAA
CTTGCTTAATTCTAATGTACTTAATGTAATTGATATGATGAAGAAAAGTTATTAAGAGAA
TCACAAATATGCTTAGTTACCAAACAATATCAAGAAAATAAAAGAACTTAAATTAAAATA
TTTAGAATTAAAGAATATGAAATGCAAATTACAACCTCCAGGAATCGATGAACTTCCTAT
TGAGAAATACATATAAAGTTCTTAAATTATGAGATAATTAAATAAAAACTATTTCTAACA
AGTAAAAACATACATGGTAGAAAAGATGGAGCTTCCTTCTTACTGTGTCATGTACGATGA
CGTTTACAAATTCTATTTTGGGATGATTATTTATATCAATCTTAAAGATAAATACGAAGA
CAGATTCCTATATGTTTTATATGTAGATAGTATTGATGTCCAACAAGGACCTATTTTTAA
TTTCCAAGAAGATGCATTCCACTCACATGTTGTCGAAAATCACCATTACTGTGATGAATC
TAACGACTACAAAGAATATACTTACAAAATATTTAAGCTGCCCGTTTCTTGCATTTGTAA
GATATACGAAGATGACCCTGGAATTGAAGATGGAGAATTAGAAGATTAAGAATATGTTTA
ATCATGCGTTAAGTTGCTTATTTCTAAAAAAAATTAATTTAAAGAGGTTTTTCTATCTGA
AGAAATCTCATCTGTAAATTTGTTCAAATATCTTTAATTTATTTATTTATTTCTTTATTT
TAATTTTGTTTAGAAAAAAATGAAGAGGAAAAAATTCTTGGATATGAAATTCTAAAACAC
AACTGACATATCAAAATCTGCACTAAATAATAATTTAGACTCAATATAAACTTCACTTTG
TCATTAATGTGATATCAAAGATTTGCATATTAGCCAAGTCTTCGAAAGAAAGTAAATTAA
AACTGATCTAGAAGAACTTATTAAAAAAGTAGATGAAAATGACTTAAATCAAAGAACAAG
TTTTGAAAGGTAGATTTTATTTTTACTTTTATTATTTATTTTGAAAGTTTAAAATAATTA
TTTTGCAATTAGTAAATTGAAGATTTTGAAAAGATTTGGTTATGTTGATTTAGTTAACAA
ACCTACTTTTAAGGCTCGTATAGCTAAAGAAATACAAAATATTTATGTCACAGAGGTAAT
ATTCTAAGAATCTCTTGAATCTTTAGAAGAATGTGACATAGCAGCTCTTCTAAGTGGTTT
TGTATGTTAAGCTAAATCTAAAAGTGCAGTTAAATATGACCCAATAGATGACTTTAGCCC
TTTCTATCCTAATTATGATAATTTTATGGAATCTTATCTAGAAATTATATAATCTGTCAA
GGCTGTTATCTCTTACGAATGTTAATTCGGAGTAAATTATAAATAAATAAATAAAGAGTA
AGTTTCTTAACATATTTAATTTTATTTTAGGTTATTCAATGTGGTAATGAAGATGACTAT
ATGTTTGATCAAGTTTATATAAGAGACTTAATTGAAGTTGTATACTAATGGATGAATGGA
ATGGATTTCTAAAATATTTGCGAAATGACATCTATATAAGAAGGTGCTATAGTAAGAAGC
TTCCTTAGACTTGAAAATTTACTCAAAAATGTAAGAAATGGTTATATTATTATGGGAAAT
TATGCAATGGGAGTTAAACTAGACAGATGCATGGAAATGCTCAAGAAAGATATAATTTTT
TCTAAAAGTTTGTATTTAGACTAAGACGATCATTGA


>TTHERM_00628520(protein)
MNGQEDQLLQAFDWLIYANQSRIPKILDFEQQLFQFDVKDQALPSHFQVVINNPERQNTQ
LYLNNHFTSVHYEESFADLKYIKKGQLERRILKDIYEHDVDLMGFQFDQNQVESEMLDIG
YKRALDEVDLHLKNPFTTTFSYDYMDNEFTGFQDQMVQNNSFKNYSTDQSQDNTQQQQKG
QQLLNEYYNQGNASQEINAQQVQGYQSQNNIVEDFQVLGNQVEQYLAELRQKQQSIKNRI
NIPQLSLEDLIKVNKFSRVLSIFQKAGQKEAKKHKVIQKSTVDMDPEEIFKQLKSEWVEE
QKEEEELKQSYELQILANLDFDVMIDKVEEKIQFEEQQLLEKVKKMQEELKSQSFEMQED
QIYSLGQQNKMEQFNKIKLVDTQEINEKKLQLSSSYDWAVEDQFNLAKFYEEVPKEKMAQ
QYPFELDAFQKRSVYRIERKESVFVCAHTSAGKTVVAEYAIAISKKLNRKAIYTSPIKAL
SNQKYRDFKQKYGDDVGLVTGDVQLNPNANCLIVTTEILRNMLYRNNDIIRDIEWVIFDE
VHYLNNPERGLVWEETIIMLPETVGFVMLSATVPNYMEFANWVGRTKKRKIYVQKTDFRP
VPLEHSIYLNGSIEVIKQGDNRFNATDYDQFKNRIIKTYMNQKNQLTAQKKSLKLEKYQK
GILKNTNTSMRNKRTMKAITEKFIKSTDEDDYNSSSSTNEGFNLMQLLIKCQNENLLPCV
IFCFSKRKIDEIANQIKQLNFCDYEETVRIEYYFRQCSRKIKSRDLNVPQIQTIKDLLLR
GIGIHHGDVIPFMKEVVEILFSQSLIKVLIATETFAMGINMPTKTVIFHSLKKFDSSGER
LLNSSEFTQMSGRAGRRGLDVKGNVIIFVNSIEQLPSKNDLNIIMDTKGQYLESKFKITY
ETIINLLNSNVLNVIDMMKKSYQENHKYAQLPNNIKKIKELKLKYLELKNMKCKLQPPGI
DELPIEKYIQSSQIMRQLNKNYFQQVKTYMVEKMELPSYCVMYDDVYKFYFGMIIYINLK
DKYEDRFLYVLYVDSIDVQQGPIFNFQEDAFHSHVVENHHYCDESNDYKEYTYKIFKLPV
SCICKIYEDDPGIEDGELEDQEYVQSCVKLLISKKNQFKEVFLSEEISSKKMKRKKFLDM
KFQNTTDISKSALNNNLDSIQTSLCHQCDIKDLHISQVFERKQIKTDLEELIKKVDENDL
NQRTSFESKLKILKRFGYVDLVNKPTFKARIAKEIQNIYVTEVIFQESLESLEECDIAAL
LSGFVCQAKSKSAVKYDPIDDFSPFYPNYDNFMESYLEIIQSVKAVISYECQFGVIQCGN
EDDYMFDQVYIRDLIEVVYQWMNGMDFQNICEMTSIQEGAIVRSFLRLENLLKNVRNGYI
IMGNYAMGVKLDRCMEMLKKDIIFSKSLYLDQDDH