Identifiers and Description

Gene Model Identifier

TTHERM_00630270

Standard Name

GST12 (Glutathione S-transferase mu 12, TtGSTm12, GSTm12)

Aliases

PreTt06542 | 89.m00136 | 3831.m01436

Description

GST12 glutathione S-transferase amine-terminal domain protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_04321.1 4.997748715790535e-135
Description: glutathione S-transferase domain-containing protein (209 aa)
Oxytricha Contig16299.0.g15 1.000116773704384e-19
Description: Glutathione S-transferase, N-terminal domain
Stentor Coeruleus SteCoe_29804 0.0000003059023205018258
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00630270(coding)
ATGTCTTCTAATACTATCACTTTAGGCTACTGGGCTCTCCCTTTAAGAGGATAACCAATT
AGATATATTTTTGAATTAGCTAAATTTCCCTATTAACAAACTCTTTACACTTCTGCCACT
GCATCTAACTGGTTTGGTAAAGACAAACAAGAACTCGGATTAGATTTCCCCAATTTGCCT
TATCTTATTAAAGGAGATTTCAAGATTACTGAATCTTAAAATATTGTTAACTATGCAATT
GATATCACTAAATAGCAACATTTATTAGGAACAGGTTAAAAAACATTCAAAATTGACAAT
ATTAGATTCTTCTGCGACGAATTGACTAGCAAGGTATTTTTGGCCACAAGAAAAAGTGGA
GAAGAAAAGACAACTGAAATAAACAACGTTTTAATTCCTAAGTTTAAATACTTGCACAAG
TAATTAGGAAACAATGTTTATTTCTTTGACAACAAGTTATCTCTTGCTGATATATTTGCC
TACACTGCAATCAATGTCTTCAAGCTTAAGTTCAATGAAGAATACTAACAATTTTCATCA
ACCTTCGACCCCTTCATGAAAAACTTCGAAGAAATACCTTTAATTAAAGAATACCACAAC
TCTGATCGTTATCCTAAAATGCCTTGA


>TTHERM_00630270(gene)
ATGTCTTCTAATACTATCACTTTAGGCTACTGGGCTCTCCCTTTAAGAGGATAACCAATT
AGATATATTTTTGAATTAGCTAAATTTCCCTATTAACAAACTCTTTACACTTCTGCCACT
GCATCTAACTGGTTTGGTAAAGACAAACAAGAACTCGGATTAGATTTCCCCAATTTGCCT
TATCTTATTAAAGGAGATTTCAAGATTACTGAATCTTAAAATATTGTTAACTATGCAATT
GATATCACTAAATAGCAACATTTATTAGGAACAGGTTAAAAAACATTCAAAATTGACAAT
ATTAGATTCTTCTGCGACGAATTGACTAGCAAGGTATTTTTGGCCACAAGAAAAAGTGGA
GAAGAAAAGACAACTGAAATAAACAACGTTTTAATTCCTAAGTTTAAATACTTGCACAAG
TAATTAGGAAACAATGTTTATTTCTTTGACAACAAGTTATCTCTTGCTGATATATTTGCC
TACACTGCAATCAATGTCTTCAAGCTTAAGTTCAATGAAGAATACTAACAATTTTCATCA
ACCTTCGACCCCTTCATGAAAAACTTCGAAGAAATACCTTTAATTAAAGAATACCACAAC
TCTGATCGTTATCCTAAAATGCCTTGA


>TTHERM_00630270(protein)
MSSNTITLGYWALPLRGQPIRYIFELAKFPYQQTLYTSATASNWFGKDKQELGLDFPNLP
YLIKGDFKITESQNIVNYAIDITKQQHLLGTGQKTFKIDNIRFFCDELTSKVFLATRKSG
EEKTTEINNVLIPKFKYLHKQLGNNVYFFDNKLSLADIFAYTAINVFKLKFNEEYQQFSS
TFDPFMKNFEEIPLIKEYHNSDRYPKMP