Identifiers and Description

Gene Model Identifier

TTHERM_00632820

Standard Name

MRNN05 (Membrane Occupation and Recognition Nexus protein N-terminal)

Aliases

PreTt27951 | 90.m00115

Description

G10 protein; Protein with predicted MORN domains localized at the N-terminus of the protein. G10 protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_15783.1 9.997093137033517e-262
Description: hypothetical protein (789 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00632820(coding)
ATGACTTCAAGAAACCCTTTATTTATATCCAAAAGTTTTTTCGAAATTATCCCGCCTGAG
CAAGAAGTGAGAAATGGAATTTATGAGGGATAATTAGTTCAAAATAAAAGATAAGGAAAA
GGGATTTTTATTTGGGATGACTCTTCAGTATATGTAGGTGATTGGCTTAACGATCAGCCT
CACGGAGAAGGTATTCTGTTTTTGAACCATGGCTGCTATGCATTCGGTTCTTTTGAAGGT
GGAAAATTGAATGGTAAGGCTATGGTAAAATTTGCAAATGAAAGCAGGATTTTTGGACAA
TGGAGATAGAACCAGTTAAGAGGAATTTGTTTCTTTTACGACCACGAAAAAAGAGAGTGG
AAAATGTGTGAATTTAAGTAAGGAGTTCTTTTTAGAATACTTGAAATACAAGAAAATTCA
CCAATGGGTTAATAGTCTTAGTTTTTTTCTGCAAGTAGTCCTTATAATTATATTCTGAAT
ACAGATATTCCAATTCCTCTTTTCCCTCAATTTTCAAGAAGAGATTTTGAGTTATTTTCA
TTGAGCAGCATTCTCTAGAGAATCACTAATATTTCTTAAAACACTATCATAGGACAAAAA
TAATTAGCTTTCATAAATCTTGGAGAAGAGCTGAATTATTTTGGTTTAATTTAAAATGGA
ATACCTGAAGGGCTAGGTGTGACTTTATCAGGAGATATTCTGAAAAACATTGGAACTTTC
AAATAATCAATAATGCAAGGTATCGGGAGAATTTACAGTGAAAATGGATTAATTTTTGAT
GGAAACTTTGAAAAAGGACATTTAAGTGGATTAGGGTATTTGTATAACAGTGAAACAAAT
ATATTTTATGAAGGACTTTTCTATGAAAACGAGTGCAATAAATTGTTTAAAAAATCAAAA
GGCTTTCAAATAGAAACTATTATAAAGCAAAGGTAAAATTAGCATAAATAAGGTTGCTGC
TTTAGAAATTAAATACTTGTTTTGGAGATATGTCAAATATTAAATGGTTAAATGCCATTA
TTAAATCTTTTTAGAAACAGCAAATCCTTTAACACTGAGGAAGTTTAATCTATAGTGTAA
GCAGATAATAACCCTATTTACAGTTTTATTTAAGCTAACAAAGAATACATAGAAAATAAA
AGACACAATTGCTTTTTTTATCCAAATTAAATAGTTAATAGATAGTTATTTAATACTTCT
TCTCTTTCTTCTCATCAAGGTTTATAAATAAATTCTTATCCGTATGAAGAATATGAGTTT
TCTCTTCATGAATTTCAAAGATAATTGGAAAAACCTAGATTGAGCACAATAATGGCAGAA
AACTAAAAATTTGAAGAAAAAATTAATAATCCTCAAAATAATTTTAGCAATACTAGCACA
AATAGCATCCTAAACCTTCGTAGCAATATATATCTTAGATAATAAAAGAATTACTCTTCC
CCTGGATAGAATAGGAACCTCTAATCTGCAATAAATTCTAATCAAATGAATACAAAGACT
TCTTCTCCCTTAGAAAAAACTCCAGAAAGCTACGTCTCTTACTTCAATGATTTACAAGCC
TAAACTCCTTAAAGAAAAACCCCTCTATAAAAAAAATATTCAATTGAAAATAGCTCTCTA
GAAAAAAAACAAATGTTTTCAAACACTCAAGGATCAAATCACAATTCAGTTTCGCAGTTT
TCATAAAAAAATCCATATTTTCAAATAATACCACAAAACCAAGAAAATATAGAAAGCTAG
AGAAATTCATCATTAAAAAAAAATTAAAACCAAAATTCTTCAGATAAAAATTATGAAAAT
CCAATGAAGCTTTAAAATCCTTTTTATAATACAAAGACGACAAAAAAATAAGGGAATTGG
CTCTATGAGCAAATAAGAGCTCGAAGTAATACTCCTAATTTGAGATACAACGATGACAGA
AATAATATTAGTAATAATAACACAATCAATATTCATTCTATTGATACAGTAGTTGAAAGA
AACATGTCGAATAATTAAAGTCAAAATTTAAGTTAAAGCTATATTTAAAATAACTCTTTG
AATAGTTTTAATAATTAAAAAAATGGTTTTTATCAAAAAAATAATCATCAACCCAACATT
CAAATGAAGAATTAATAATATTCTTCTATTTAAAATCCATTTAAAAGCTAAATTAATGTG
ACTCATAATACAAGTTATTCTTCAATTAATTAAAACAACAATTTGAATGAGACAAAAAAC
CAAATGAGCAACCAATATATTCCTAAGAGCAAAATTTTCAATAGACCTAAAAGCAGTTTA
AATCAGATGACATAAAATATGCAACAATAGTAGATTTCTTAAAGAGAACTTGCCTAACCT
ATTAGATTTTAGACCACAAATGAAAGTATCAGTAAAAGAAGCATTTCTCCTTTTTAGAGC
TACAACACTTCTTATAATTAATAATAAAACAACAGGAGTAGGAGTACTTCAAAACAGGTC
TCACCACTTAGAACTAAGCAAAAATCTAATAACAATTTTTCTCCAATAGTATAAAATATT
TATAGAAAAAATAGCTCCTCATAAAATAAATTGTTTTAATAATAAACAACTCAGCAAAGA
GATTCAAAAGATTTGACTAATTAAAATAGTTTCATTTAAAAAAACAAAAAAATGTAACAA
AAGAAACAAAAAGAAAATATAAAATAAGTTCATCTTCGACTCCCAAGCTCTTTTTTTAAG
TGA


>TTHERM_00632820(gene)
ATGACTTCAAGAAACCCTTTATTTATATCCAAAAGTTTTTTCGAAATTATCCCGCCTGAG
CAAGGTAAAATGCAATTAAAATGAATTCAACGAGTTATCATTTAGAAACTTGTTCATATC
TAAGAAAAGACATGATGAAAAAACTTATTTTATTTTAAAATTGAAAATAATTAGATGTGA
TTTACACAGAAGTGAGAAATGGAATTTATGAGGGATAATTAGTTCAAAATAAAAGATAAG
GAAAAGGGATTTTTATTTGGGATGACTCTTCAGTATATGTAGGTATTTACTAACAGTTTT
AATTTATATTTTAGAAGAATTCATAATTTTTATTCTCACATTTAACATCAAACATATTTA
TATTAATTAGGTGATTGGCTTAACGATCAGCCTCACGGAGAAGGTATTCTGTTTTTGAAC
CATGGCTGCTATGCATTCGGTTCTTTTGAAGGTGGAAAATTGAATGGTAAGGCTATGGTA
AAATTTGCAAATGAAAGCAGGATTTTTGGACAATGGAGATAGAACCAGTTAAGAGGAATT
TGTTTCTTTTACGACCACGAAAAAAGAGAGTGGAAAATGTGTGAATTTAAGTAAGGAGTT
CTTTTTAGAATACTTGAAATACAAGAAAATTCACCAATGGGTTAATAGTCTTAGTTTTTT
TCTGCAAGTAGTCCTTATAATTATATTCTGAATACAGATATTCCAATTCCTCTTTTCCCT
CAATTTTCAAGAAGAGATTTTGAGTTATTTTCATTGAGCAGCATTCTCTAGAGAATCACT
AATATTTCTTAAAACACTATCATAGTAAATTAATATTTTCGCTTTCTAAACATTTCTAAC
TTCTTTCTGTATTTATTTATCTATTAATTTTGTTATTACACAGGGACAAAAATAATTAGC
TTTCATAAATCTTGGAGAAGAGCTGAATTATTTTGGTTTAATTTAAAATGGAATACCTGA
AGGGCTAGGTGTGACTTTATCAGGAGATATTCTGAAAAACATTGGAACTTTCAAAGTAAT
GTTTAAAAAAAATATTTTAATATTATTTAAAATAATGAATTCTTTTTGAAGTAATCAATA
ATGCAAGGTATCGGGAGAATTTACAGTGAAAATGGATTAATTTTTGATGGAAACTTTGAA
AAAGGACATTTAAGTGGATTAGGGTATTTGTATAACAGTGAAACAAATATATTTTATGAA
GGACTTTTCTATGAAAACGAGTGCAATAAATTGTTTAAAAAATCAAAAGGCTTTCAAATA
GAAACTATTATAAAGCAAAGGTAAAATTAGCATAAATAAGGTTGCTGCTTTAGAAATTAA
ATACTTGTTTTGGAGATATGTCAAATATTAAATGGTTAAATGCCATTATTAAATCTTTTT
AGAAACAGCAAATCCTTTAACACTGAGGAAGTTTAATCTATAGTGTAAGCAGATAATAAC
CCTATTTACAGTTTTATTTAAGCTAACAAAGAATACATAGAAAATAAAAGACACAATTGC
TTTTTTTATCCAAATTAAATAGTTAATAGATAGTTATTTAATACTTCTTCTCTTTCTTCT
CATCAAGGTTTATAAATAAATTCTTATCCGTATGAAGAATATGAGTTTTCTCTTCATGAA
TTTCAAAGATAATTGGAAAAACCTAGATTGAGCACAATAATGGCAGAAAACTAAAAATTT
GAAGAAAAAATTAATAATCCTCAAAATAATTTTAGCAATACTAGCACAAATAGCATCCTA
AACCTTCGTAGCAATATATATCTTAGATAATAAAAGAATTACTCTTCCCCTGGATAGAAT
AGGAACCTCTAATCTGCAATAAATTCTAATCAAATGAATACAAAGACTTCTTCTCCCTTA
GAAAAAACTCCAGAAAGCTACGTCTCTTACTTCAATGATTTACAAGCCTAAACTCCTTAA
AGAAAAACCCCTCTATAAAAAAAATATTCAATTGAAAATAGCTCTCTAGAAAAAAAACAA
ATGTTTTCAAACACTCAAGGATCAAATCACAATTCAGTTTCGCAGTTTTCATAAAAAAAT
CCATATTTTCAAATAATACCACAAAACCAAGAAAATATAGAAAGCTAGAGAAATTCATCA
TTAAAAAAAAATTAAAACCAAAATTCTTCAGATAAAAATTATGTAAAATTTTTTTATTTT
CTTTTTCAAAAGTCATTCTTTTCTTTTTAAAAATCAATTTACTTAGAAAATAAAAATAGT
TTTTAATAAAAAATGAGTATTTTGTGATTTAAATTAATTAAAGAAGCTAGGATTTTATTT
AAAAATATTTAATTGATAGCTATGATGGATATGATTTAGAAATTAAATTTATTGATAAGT
TTCTATTGATTTTCAGAATAACTTTTCAAACTAAAAAATTAATACAAAACAAATTCAATT
TTTAAATGAAAATAAAAAAAGAAATAATTAATTTTTTTAATTTAATTAATAAATTTTAAA
TGGGAATTTTGATATTTTGATATTTAATTTTAATTATTTGAATGAATTTTATTAATAAAT
TATAAAAAATCATAGGAAAATCCAATGAAGCTTTAAAATCCTTTTTATAATACAAAGACG
ACAAAAAAATAAGGGAATTGGCTCTATGAGCAAATAAGAGCTCGAAGTAATACTCCTAAT
TTGAGATACAACGATGACAGAAATAATATTAGTAATAATAACACAATCAATATTCATTCT
ATTGATACAGTAGTTGAAAGAAACATGTCGAATAATTAAAGTCAAAATTTAAGTTAAAGC
TATATTTAAAATAACTCTTTGAATAGTTTTAATAATTAAAAAAATGGTTTTTATCAAAAA
AATAATCATCAACCCAACATTCAAATGAAGAATTAATAATATTCTTCTATTTAAAATCCA
TTTAAAAGCTAAATTAATGTGACTCATAATACAAGTTATTCTTCAATTAATTAAAACAAC
AATTTGAATGAGACAAAAAACCAAATGAGCAACCAATATATTCCTAAGAGCAAAATTTTC
AATAGACCTAAAAGCAGTTTAAATCAGATGACATAAAATATGCAACAATAGTAGATTTCT
TAAAGAGAACTTGCCTAACCTATTAGATTTTAGACCACAAATGAAAGTATCAGTAAAAGA
AGCATTTCTCCTTTTTAGAGCTACAACACTTCTTATAATTAATAATAAAACAACAGGAGT
AGGAGTACTTCAAAACAGGTCTCACCACTTAGAACTAAGCAAAAATCTAATAACAATTTT
TCTCCAATAGTATAAAATATTTATAGAAAAAATAGCTCCTCATAAAATAAATTGTTTTAA
TAATAAACAACTCAGCAAAGAGATTCAAAAGATTTGACTAATTAAAATAGTTTCATTTAA
AAAAACAAAAAAATGTAACAAAAGAAACAAAAAGAAAATATAAAATAAGTTCATCTTCGA
CTCCCAAGCTCTTTTTTTAAGTGA


>TTHERM_00632820(protein)
MTSRNPLFISKSFFEIIPPEQEVRNGIYEGQLVQNKRQGKGIFIWDDSSVYVGDWLNDQP
HGEGILFLNHGCYAFGSFEGGKLNGKAMVKFANESRIFGQWRQNQLRGICFFYDHEKREW
KMCEFKQGVLFRILEIQENSPMGQQSQFFSASSPYNYILNTDIPIPLFPQFSRRDFELFS
LSSILQRITNISQNTIIGQKQLAFINLGEELNYFGLIQNGIPEGLGVTLSGDILKNIGTF
KQSIMQGIGRIYSENGLIFDGNFEKGHLSGLGYLYNSETNIFYEGLFYENECNKLFKKSK
GFQIETIIKQRQNQHKQGCCFRNQILVLEICQILNGQMPLLNLFRNSKSFNTEEVQSIVQ
ADNNPIYSFIQANKEYIENKRHNCFFYPNQIVNRQLFNTSSLSSHQGLQINSYPYEEYEF
SLHEFQRQLEKPRLSTIMAENQKFEEKINNPQNNFSNTSTNSILNLRSNIYLRQQKNYSS
PGQNRNLQSAINSNQMNTKTSSPLEKTPESYVSYFNDLQAQTPQRKTPLQKKYSIENSSL
EKKQMFSNTQGSNHNSVSQFSQKNPYFQIIPQNQENIESQRNSSLKKNQNQNSSDKNYEN
PMKLQNPFYNTKTTKKQGNWLYEQIRARSNTPNLRYNDDRNNISNNNTINIHSIDTVVER
NMSNNQSQNLSQSYIQNNSLNSFNNQKNGFYQKNNHQPNIQMKNQQYSSIQNPFKSQINV
THNTSYSSINQNNNLNETKNQMSNQYIPKSKIFNRPKSSLNQMTQNMQQQQISQRELAQP
IRFQTTNESISKRSISPFQSYNTSYNQQQNNRSRSTSKQVSPLRTKQKSNNNFSPIVQNI
YRKNSSSQNKLFQQQTTQQRDSKDLTNQNSFIQKNKKMQQKKQKENIKQVHLRLPSSFFK