Identifiers and Description

Gene Model Identifier

TTHERM_00633530

Standard Name

PUP1 (20S proteasome core beta subunit 2)

Aliases

PreTt28022 | 90.m00186

Description

PUP1 proteasome subunit beta type protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

  • 17-beta-hydroxysteroid dehydrogenase (NADP+) activity (IEA) | GO:0072582

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_15827.1 4.0006013729588566e-158
Description: proteasome A-type and B-type family protein (323 aa)
Oxytricha Contig17526.0.g72 2.9993408039826107e-81
Description: Proteasome subunit
DictyBase DDB_G0283679 4.000010081770683e-74
Description: psmB7 on chromosome: 4 position 967091 to 968259
SGD YOR157C 7.999439018944131e-69
Description: PUP1 Beta 2 subunit of the 20S proteasome; endopeptidase with trypsin-like activity that cleaves after basic residues; synthesized as a proprotein before being proteolytically processed for assembly into 20S particle; human homolog is subunit Z
WormBase WBGene00003948 1.9992362000979228e-56
Description: locus:pbs-2 Proteasome subunit beta type status:Confirmed UniProt:O62102 protein_id:CAB16855.1
Stentor Coeruleus SteCoe_28688 8.194012623990515e-40
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00633530(coding)
ATGAGTTACTTGAATGCCATTAAAGAAAACTAGGGAGGATTCAATTTCGATTTATGTTTG
AGAAATAATGAATTAGTTTCCAAGCAAATCGTTTCCAGCCCTCATTTCACTAAGACTGGT
ACTACAATTGTAGGTTTAGTTTATAAGGATGGTGTTGTTTTGGGTGCTGATACCAGAGCT
ACTGCTGGCACTATTGTAGCTGAAAAAAGTTGCAGCAAAATTCATTATATTGCTCCTAAT
ATGTATTGCTGTGGTGCAGATACCTAATGGGTTACTGATAGACTCTCTTCTGAATTAGAA
TTAATGAGACTCAACACCAATAGATAATCTAGAATTGCTGGTGCTATTGCTCGTCTTAGA
GAACATTTATATCAATATTAAGGTCACGTCGGTGCTCACTTGATTTTAGGTGGTTTTGAT
TGCCAAGGTCCTCAATTAGTATCCGTTGCTGCTCATGGTTCTTTCTCTTATCTTCCTTAT
GCTACCATGGGTTCAGGATGTTTGGCTGCTATTGCCACTTTAGAATCTAGATATAGAGAC
GATTTAACTGAATAAGAAGCTATCGATTTAGTTACTGCTTCAATTGAATCTGGTATTGTT
CACGATTTAGGTTCTGGTTCCAACGTTGATGTATGTGTTATTAAAAGAGATCCTAAGGTA
GATGTTAAAGTAGATTACTTAAGACTTCATAAGACGTATATTTATTTATTTTATATTTTC
AAGCAAGTTTAAATAAATAAATGTATATAAAAAAAGCGATAACAACCAAAGACTTAACAA
GCCATTCCCTTACAAAGCTATTCCTAACAACCACCCCTTCCATAGATAATTCAATGTTCC
CATCGAAAAAATTCCCGTTAATGTCGATCCTTCTAAAAACGAAATGGAAGTAGAATGAGA
AAAATAATAATGCGAGCAAATTCGTTTTTGGCATTACTTTTTTATAAAATATACTTAAAA
AATAAAATAAAATATAATTAAATGTAATTTAAAACATATATTTTTAACGACTTCATACAC
GTATTTTTACCAAAATTTAAAAATTTATTGAAGATAAATTAAAATATTTGCATATCTATT
TTTATAATTTTTTTAAATAAATAATTCGTTAATAATTTACAATAAAATCATTCGTTAATA
AAGTACAATAAAATCGAACATGAAATATTTTTATTGGATTTATGA


>TTHERM_00633530(gene)
ATGAGTTACTTGAATGCCATTAAAGAAAACTAGGGAGGATTCAATTTCGATTTATGTTTG
AGGTAATTTAGCAATTCTGTTTAATGTTTGCATCATTTAGTTAGTTATTCTTGATGATTC
ATAAAGCTAACTAACTTTGCACTTGATCAATTAACATTCATTTTTAAAACTAGAAATAAT
GAATTAGTTTCCAAGCAAATCGTTTCCAGCCCTCATTTCACTAAGACTGGTACTACAATT
GTAGGTTTAGTTTATAAGGTATATTGATTGATTGATCAGTTAATTTATTTATCAATTTGG
CACAACCATTCTTAAACATCTTTACTTTTACAAGCCTTAGCTGACTTCTTTTAATAATTA
TAACAATAAAGGATGGTGTTGTTTTGGGTGCTGATACCAGAGCTACTGCTGGCACTATTG
TAGCTGAAAAAAGTTGCAGCAAAATTCATTATATTGCTCCTAATATGTATTGCTGTGGTG
CAGGTAAAATTAAAAATTTCTTTAATATATTAAGGAGATTAAGATTTTTTAAACTTAAAA
ATAAATAGGAACTGCTGCTGGTAATAATTAATTAATTAATTCTTTGATCATTTGTTTAAA
AAGAAAGAAAAAAATGGATTATATCATAATTTAACATGAAGATATTTGCAAGAAATGACT
TGCTTTCAAAGCTATTTTAGATTTTTTCATTATACAATTCTGCAATTACAATAAGAATAA
AAGATCAAAGGCTTTTTTGTCAAAAAAAAATAATTAATGATTTTCTTTTTACAAAACAGA
TACCTAATGGGTTACTGATAGACTCTCTTCTGAATTAGAATTAATGAGACTCAACACCAA
TAGATAATCTAGAATTGCTGGTGCTATTGCTCGTCTTAGAGAACATTTATATCAGTAAAA
TAATCAAATTCACTATATACTATTATTAATTTATAGTTCTATATTGATTTTTATTTGAAT
TTATTTGAAGATATGCTTAAAATAATTAACAAATAGATATTAAGGTCACGTCGGTGCTCA
CTTGATTTTAGGTGGTTTTGATTGCCAAGGTCCTCAATTAGTATCCGTTGCTGCTCATGG
TTCTTTCTCTTATCTTCCTTATGCTACCATGGGTTCAGGATGTTTGGCTGCTATTGCCAC
TTTAGAATCTAGATATAGAGACGATTTAACTGTAATTTTTACAACTTATATATATATAAT
TATCAAACAAAAACATGTTTTTCAATCATTTTCGAAGAGGAAAATATTTAAATAATATAT
ATTTAAAAAAAATAGGAATAAGAAGCTATCGATTTAGTTACTGCTTCAATTGAATCTGGT
ATTGTTCACGATTTAGGGTAAATAAAATAATATAAAAGAAAGAATAGGTTTTAAAACATA
TACTAATTTAAAATAGTTCTGGTTCCAACGTTGATGTATGTGTTATTAAAAGAGATCCTA
AGGTAGATGTTAAAGTAGATTACTTAAGACTTCATAAGACGTATATTTATTTATTTTATA
TTTTCAAGCAAGTTTAAATAAATAAATGTATATAAAAAAAGCGATAACAACCAAAGACTT
AACAAGCCATTCCCTTACAAAGCTATTCCTAACAACCACCGTAACTATTTTTTACTTAAT
TACTTCATGAAGAGATCTAAACAATATTTAATTAAAAAATAGCCTTCCATAGATAATTCA
ATGTTCCCATCGAAAAAATTCCCGTTAATGTCGATCCTTCTAAAAACGAAATGGAAGTAG
AATGAGAAAAATAATAATGCGAGCAAATTCGTTTTTGGCATTACTTTTTTATAAAATATA
CTTAAAAAATAAAATAAAATATAATTAAATGTAATTTAAAACATATATTTTTAACGACTT
CATACACGTATTTTTACCAAAATTTAAAAATTTATTGAAGATAAATTAAAATATTTGCAT
ATCTATTTTTATAATTTTTTTAAATAAATAATTCGTTAATAATTTACAATAAAATCATTC
GTTAATAAAGTACAATAAAATCGAACATGAAATATTTTTATTGGATTTATGA


>TTHERM_00633530(protein)
MSYLNAIKENQGGFNFDLCLRNNELVSKQIVSSPHFTKTGTTIVGLVYKDGVVLGADTRA
TAGTIVAEKSCSKIHYIAPNMYCCGADTQWVTDRLSSELELMRLNTNRQSRIAGAIARLR
EHLYQYQGHVGAHLILGGFDCQGPQLVSVAAHGSFSYLPYATMGSGCLAAIATLESRYRD
DLTEQEAIDLVTASIESGIVHDLGSGSNVDVCVIKRDPKVDVKVDYLRLHKTYIYLFYIF
KQVQINKCIQKKRQQPKTQQAIPLQSYSQQPPLPQIIQCSHRKNSRQCRSFQKRNGSRMR
KIIMRANSFLALLFYKIYLKNKIKYNQMQFKTYIFNDFIHVFLPKFKNLLKINQNICISI
FIIFLNKQFVNNLQQNHSLIKYNKIEHEIFLLDL