Identifiers and Description

Gene Model Identifier

TTHERM_00633600

Standard Name

KIN143 (KINesin)

Aliases

PreTt28029 | 90.m00193

Description

kinesin motor catalytic domain protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00225 ) Kinesin motor domain
  • ( PF04394 ) Protein of unknown function, DUF536
  • ( PF05372 ) Delta lysin family
  • ( PF07106 ) Tat binding protein 1(TBP-1)-interacting protein

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_15831.1 9.997093137033517e-262
Description: kinesin motor domain-containing protein (933 aa)
Oxytricha Contig8328.0.g40 6.000287828677204e-80
Description: Kinesin motor domain
DictyBase DDB_G0276369 4.0018838296491823e-56
Description: kif5 on chromosome: 2 position 6648064 to 6651339
WormBase WBGene00003884 2.000065869309806e-55
Description: locus:osm-3 Osmotic avoidance abnormal protein 3 status:Confirmed UniProt:P46873 protein_id:CCD70204.1
SGD YGL216W 8.99567666834855e-44
Description: KIP3 Kinesin-related motor protein involved in mitotic spindle positioning
Stentor Coeruleus SteCoe_36532 5.380186160021138e-32
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00633600(coding)
ATGAACAGATAAAATAAGTTTAATTTGTAAAATCAGCAATAATAATTTTAATAAAACTGG
CGATATAATGAGAGTGATGAAGAAGGAATGTATTATGAAGAATAGCAAAATGATATTGAA
TTTGAAAGGTAAAGTCCTTTAGCGTATAATAACTACAATACATTTAACAATTAGTAGTAA
AATTTAACTAATCAGTTTGAAAATTAAAATTAATATGATGAGGAATCTTTGATAATTGAA
AATCCTTTGGACTAGACACCTATTTAAGTCATGATAAGAGTTCGTCCATAATTTAATATT
GATTCATAATCAGCTTTAAAAATAGTAGATAATAATACAATTTATATCAACAACAATGAA
AATGTTCACTCATTCAAATATTCCAGGGTATTTAAACCAAGTGATAGCTAAGAAACTATT
TTTAAATATGTTTGTGAACCCATTCTTTAGCATGCTATCTAAGGTTACAATGCGTCTTTT
TTGGTTTATGGATAGACTGGAACAGGTAAAACACATACGATGGGTTTGCATCAAAACAAT
TTGTTAGAAGAACCTGGTATGATTTAGCATTCTTTAAAATTCTTGTTTGACCACTTTAAT
AACAGTCAACTAAACCCTGAAGATTGGTCTATCAGTTTGAATTTTATGCAAATATATATT
GAAGAGATTTTCGATTTACTAAATCCAAATGGATAAAAATTGTAAATTAGGGAGGACTCT
GAAAGCAACGAAGTTTATGTCTAAGATTTAATTACAGTTCCTATAAAAAATATCGATTAA
GCTATAAAATTAATTGAAGCTGGTTTAAATTAGAGAATGTTGGGTCCATAAAATATGAAT
TAATATTCTAGTAGATCTCATACAATTTTAAATGTTTACGTAAATCAAAGAATCTCATAT
AGTGAATACATTGTTTCAAATATAGCTTTTGTCGATTTAGCAGGTTCAGAAAGAATTAAG
AAATCAAATTCAACAGGAATAAGAATGGAGGAAGCTAAAAAGATTAATAGTAGTTTAAGT
GCTTTAAGCAATGTAATTTCATTATTGGGAAACTCTAATCAACAGTATATCCCTTATAGA
GATTCTAAGCTTACAAGAATTCTTTAAAATTGTTTGAATAGTCAAAGTAAAATATCAATT
ATTGGAACAGTTGAACCTTCTGAAGATAATAGCTTTGAAACCTACAGCACATTACTCTTT
GCTTCAAGATGTTAGGATATTTAATTTCTTCCTTAGTAAAACCTTCAAAATATCTTCACC
ATGAATAGCGATCCTTAAGAAGAAATTTAAAATTTAAAGGATTAAATCAAATATTATCAA
AGCAAAATTAAAAAAATGTCTTCTTCTATTTCTTCTGATGGGACTAAGTTTGCCAAATAA
ATAATTGAAACTCTGAAAAAACCATTTACTAAACTAGGAAGAAACTTAAAATAAGCTCAG
AAAATGAACGAGTAATTGCATTCTTAAATGAAAAACAAAAAAAATACCTCATATGAACCT
ATAGGGTTATATTAAGCTAAAATTCCTTTTGAGGAAATGATGTAAATGATCAGTGATGGC
AAGGAACAGGAATTCTTGAATTTGTTTGAATAAACTTTTGAAGATATTTTTTAAAAATAC
GGATAGATTTCTTTGGAATTAGAGAAATTAAAGGAAGTAAATTTAGCTAATTAAAACTAG
AAGACTGATGATCATCAGTAATTAACATCAAGCAGACCAAATACAAAATTGGCTACTGAA
TTAATAGAATATTATTCAGGTTTCAGTCAAACATTACTAAAATAATTGTTGGAATCAGAA
TAAATAGTAGATACAAATGATAGAGATCTATTAGAGAAAATTGGGGAATTCAATTAATAA
ACATAACTTAAACTAAAAGATATAGTAAAAAAACATAATATTAAAGAATTAATTTAGTAT
GTAGACACTTTGAATGAAACAAATTATGAAAAAATTGCTAAATCTGAGTCATACAGAGTT
AAATAGCTTGTCTTATAACTCAAGAAAAAAATAGAAGATACTGCTCAAAAAAATAATGAT
AAATCTAATACAAATATAAAAGACTTCTTAGAAAAGTAGAGACTTATAAATGAAAAAAAG
TTTATGATTAAATAGAGTGGAACACCTCTTAATAATTCATAAATTATAGGAGATAACAGC
AGTAGCATGAGCTTAAGAAGTAATTCAAGTAGTAATAATTTGACATAATAATAACAGCAA
CAACAATAATAATAAAATCAAGTAAATAACATCCCAAAAGGACCATCAAACTTAAAGCAG
ATGATGAATGATTTGAATTAAAAAAACAAGTAATAAACGAGCAATTCAGTAAATGAAAAT
TAAGAGAACTTTTCTTCATAGTAAGAAGGCTGTTATAATAGTAACAATATTAATAATAGC
TAAAGCAAAAAGTAAAGCTCAACTCCTATACATATATAAAGAGTGAAAATACTAAGTGAA
GATTAAATTGAAAAAAACCCATAAAATAACTTTGTAACAAATAAGCTCACAGAATAAAAT
ACAAATATTACTAAAACAGAAAAATAGAATATAAGTGAAAAGAAAATTGTTTAATAAGCC
AACTAAAATCTGAATAAAGAAATGTAATTTGATAGAAGTTCTAGTTCAGGCTCAAATAAA
ATAGATTATAACACAAATAGCTTATCTCCAATTCCATAAGAATAACAGTTGAATAGTCAA
TTAAAATCTTGTAATTTCTATAAAAAAAATTAAAAATACTCTCCTTTTACAGATAACTGA


>TTHERM_00633600(gene)
ATGAACAGATAAAATAAGTTTAATTTGTAAAATCAGCAATAATAATTTTAATAAAACTGG
CGATATAATGAGAGTGATGAAGAAGGAATGTATTATGAAGAATAGCAAAATGATATTGAA
TTTGAAAGGTAAAGTCCTTTAGCGTATAATAACTACAATACATTTAACAATTAGTAGTAA
AATTTAACTAATCAGTTTGAAAATTAAAATTAATATGATGAGGAATCTTTGATAATTGAA
AATCCTTTGGACTAGACACCTATTTAAGTCATGATAAGAGTTCGTCCATAATTTAATATT
GATTCATAATCAGCTTTAAAAATAGTAGATAATAATACAATTTATATCAACAACAATGAA
AATGTTCACTCATTCAAATATTCCAGGGTATTTAAACCAAGTGATAGCTAAGAAACTATT
TTTAAATATGTTTGTGAACCCATTCTTTAGCATGCTATCTAAGGTTACAATGCGTCTTTT
TTGGTTTATGGATAGACTGGAACAGGTAGAGATATATATATATATATTACTATATTAACC
TTAATCATATATTTTTAGAGAATATTTACTAAATTACTCAAAAAAAAAGCTTCAGGAATC
TTAGAAAATTATAATAAGCAAGATAACTTAGCATTATTTAAAAAAGTTAAAACCAAATTA
TTTCCTCCCTACACAATAAAAAAATCATATTACAAAATATTTCAAAGAGCATTTCGAGTC
TGTCTTAATAATTAAGCAAAAGCAATTATATTTGGTGTGTAACTAATTGACAATATCATA
AACGAATAAGTTAAATAATGCTAATTCAAAATAAAACTATTATTTTATGATGATCATGCT
TGATTTTTATTATGCTGTTCAAATGCATATTAATAAATTACTTTTAGATTTAGTTCAGAG
TTATGTGATATATTTATTAAATTATTAATTTTCAAAAAGCTCTATTAATAAACAATAATC
TGTCTTTTTATCTAGAATAGAGTTTACTTTATTTATCAACAAAATATGATTTAAAACTAG
AATAATTAATTTTGTTTCATTAAGTAATTATAATAAAAGCAATCAACAATACTGTAGTTT
AGTAGGAATATTGTGTTGTTTTATGACAAAAATTAATTCATCAATAGTTATTCTTTGATC
ATTGAATAATTTTATTTATGATTTTTATAAATTATTACAAATTTATCAAATAGGTAAAAC
ACATACGATGGGTTTGCATCAAAACAATTTGTTAGAAGAACCTGGTATGATTTAGCATTC
TTTAAAATTCTTGTTTGACCACTTTAATAACAGTCAACTAAACCCTGAAGATTGGTAATA
AATTAATTTTTATTGTAACAATATTTATATTTTTTATTTATTAAATAGGTCTATCAGTTT
GAATTTTATGCAAATATATATTGAAGAGATTTTCGATTTACTAAATCCAAATGGATAAAA
ATTGTAAATTAGGGAGGACTCTGAAAGCAACGAAGTTTATGTCTAAGATTTAATTACAGT
TCCTATAAAAAATATCGATTAAGCTATAAAATTAATTGAAGCTGGTTTAAATTAGAGAAT
GTTGGGTCCATAAAATATGAATTAATATTCTAGTAGATCTCATACAATTTTAAATGTTTA
CGTAAATCAAAGAATCTCATATAGTGAATACATTGTTTCAAATATAGCTTTTGTCGATTT
AGCAGGTTCAGAAAGAATTAAGAAATCAAATTCAACGTAAATCAATAAAAGCTATTAGTT
ATATTTATCATAAGTAAAATGAATTTTATATTAATTAAAAAGAGGAATAAGAATGGAGGA
AGCTAAAAAGATTAATAGTAGTTTAAGTGCTTTAAGCAATGTAATTTCATTATTGGGAAA
CTCTAATCAACAGTATATCCCTTATAGAGATTCTAAGCTTACAAGAATTCTTTAAAATTG
TTTGAATAGTCAAAGTAAAATATCAATTATTGGAACAGTTGAACCTTCTGAAGATAATAG
CTTTGAAACCTACAGCACATTACTCTTTGCTTCAAGATGTTAGGATATTTAATTTCTTCC
TTAGTAAAACCTTCAAAATATCTTCACCATGAATAGCGATCCTTAAGAAGAAATTTAAAA
TTTAAAGGATTAAATCAAATATTATCAAAGCAAAATTAAAAAAATGTCTTCTTCTATTTC
TTCTGATGGGACTAAGTTTGCCAAATAAATAATTGAAACTCTGAAAAAACCATTTACTGT
AAATAAATTTTAAAAAATAATCATTCAAATATAATTTTTTTCATTTAGAAACTAGGAAGA
AACTTAAAATAAGCTCAGAAAATGAACGAGTAATTGCATTCTTAAATGAAAAACAAAAAA
AATACCTCATGTAATTCATTCAAACTTTCATTTTTATTATTTTAAAATGTTGAATAAATT
AAATGAGTAAAAAAGTAAGTAAATTAATAAATAAATAAAGAAATAATTTTGAAAAGCACA
AAATCAAAATACTTAGTAAATCTTAAAATTAAGTTTTATTTGATTAAGAAAAGTTTGAAG
AACTTTCATTATTTATTTATCAACACTTAACTTTGAAAGAAAAAATTATTTTTATAAACA
AAAAATAAATAAGGAAAAATATTATTTATCTATTTGTTCAAGTTTGTAAGGCATTATTAA
GTGAATGAATATAATAAAGATTTGGTTAAAATAAAATCTAATAAAATAGAAAATTAGCCT
TTATTTATTTATTTATTTATTTATTTATTTATTTATTTATTTATTTTGAATATTTAAATT
AATTTCTATTTTAAGATGAACCTATAGGGTTATATTAAGCTAAAATTCCTTTTGAGGAAA
TGATGTAAATGATCAGTGATGGCAAGGAACAGGAATTCTTGAATTTGTTTGAATAAACTT
TTGAAGATATTTTTTAAAAATACGGATAGATTTCTTTGGAATTAGAGAAGTAAATTGTTC
GTTTTGATATATTTTAAAAACTATTTTTTTAAAGATTAAAGGAAGTAAATTTAGCTAATT
AAAACTAGAAGACTGATGATCATCAGTAATTAACATCAAGCAGACCAAATACAAAATTGG
CTACTGAATTAATAGAATATTATTCAGGTTTCAGTCAAACATTACTAAAATAATTGTTGG
AATCAGAATAAATAGTAGATACAAATGATAGAGATCTATTAGAGAAAATTGGGGAATTCA
ATTAATAAACATAACTTAAACTAAAAGATATAGTAAAAAAACATAATATTAAAGAATTAA
TTTAGTATGTAGACACTTTGAATGAAACAAATTATGAAAAAATTGCTAAATCTGAGTCAT
ACAGAGTTAAATAGCTTGTCTTATAACTCAAGAAAAAAATAGAAGATACTGCTCAAAAAA
ATAATGATAAATCTAATACAAATATAAAAGACTTCTTAGAAAAGTAGAGACTTATAAATG
AAAAAAAGTTTATGATTAAATAGAGTGGAACACCTCTTAATAATTCATAAATTATAGGAG
ATAACAGCAGTAGCATGAGCTTAAGAAGTAATTCAAGTAGTAATAATTTGACATAATAAT
AACAGCAACAACAATAATAATAAAATCAAGTAAATAACATCCCAAAAGGACCATCAAACT
TAAAGCAGATGATGAATGATTTGAATTAAAAAAACAAGTAATAAACGAGCAATTCAGTAA
ATGAAAATTAAGAGAACTTTTCTTCATAGTAAGAAGGCTGTTATAATAGTAACAATATTA
ATAATAGCTAAAGCAAAAAGTAAAGCTCAACTCCTATACATATATAAAGAGTGAAAATAC
TAAGTGAAGATTAAATTGAAAAAAACCCATAAAATAACTTTGTAACAAATAAGCTCACAG
AATAAAATACAAATATTACTAAAACAGAAAAATAGAATATAAGTGAAAAGAAAATTGTTT
AATAAGCCAACTAAAATCTGAATAAAGAAATGTAATTTGATAGAAGTTCTAGTTCAGGCT
CAAATAAAATAGATTATAACACAAATAGCTTATCTCCAATTCCATAAGAATAACAGTTGA
ATAGTCAATTAAAATCTTGTAATTTCTATAAAAAAAATTAAAAATACTCTCCTTTTACAG
ATAACTGA


>TTHERM_00633600(protein)
MNRQNKFNLQNQQQQFQQNWRYNESDEEGMYYEEQQNDIEFERQSPLAYNNYNTFNNQQQ
NLTNQFENQNQYDEESLIIENPLDQTPIQVMIRVRPQFNIDSQSALKIVDNNTIYINNNE
NVHSFKYSRVFKPSDSQETIFKYVCEPILQHAIQGYNASFLVYGQTGTGKTHTMGLHQNN
LLEEPGMIQHSLKFLFDHFNNSQLNPEDWSISLNFMQIYIEEIFDLLNPNGQKLQIREDS
ESNEVYVQDLITVPIKNIDQAIKLIEAGLNQRMLGPQNMNQYSSRSHTILNVYVNQRISY
SEYIVSNIAFVDLAGSERIKKSNSTGIRMEEAKKINSSLSALSNVISLLGNSNQQYIPYR
DSKLTRILQNCLNSQSKISIIGTVEPSEDNSFETYSTLLFASRCQDIQFLPQQNLQNIFT
MNSDPQEEIQNLKDQIKYYQSKIKKMSSSISSDGTKFAKQIIETLKKPFTKLGRNLKQAQ
KMNEQLHSQMKNKKNTSYEPIGLYQAKIPFEEMMQMISDGKEQEFLNLFEQTFEDIFQKY
GQISLELEKLKEVNLANQNQKTDDHQQLTSSRPNTKLATELIEYYSGFSQTLLKQLLESE
QIVDTNDRDLLEKIGEFNQQTQLKLKDIVKKHNIKELIQYVDTLNETNYEKIAKSESYRV
KQLVLQLKKKIEDTAQKNNDKSNTNIKDFLEKQRLINEKKFMIKQSGTPLNNSQIIGDNS
SSMSLRSNSSSNNLTQQQQQQQQQQNQVNNIPKGPSNLKQMMNDLNQKNKQQTSNSVNEN
QENFSSQQEGCYNSNNINNSQSKKQSSTPIHIQRVKILSEDQIEKNPQNNFVTNKLTEQN
TNITKTEKQNISEKKIVQQANQNLNKEMQFDRSSSSGSNKIDYNTNSLSPIPQEQQLNSQ
LKSCNFYKKNQKYSPFTDN