Identifiers and Description

Gene Model Identifier

TTHERM_00636970

Standard Name

RPP0 (Ribosomal Protein P0 of the large subunit)

Aliases

PreTt19700 | 91.m00115 | RPL10-E.coli

Description

RPP0 60S acidic ribosomal protein P0; Homolog of yeast RPP0- human RPLP0- bacteria RPL10; Acidic ribosomal protein P0 of the large subunit

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_03523.1 9.997093137033517e-262
Description: 60s Acidic ribosomal protein (324 aa)
Oxytricha Contig18067.0.g83 3.0014802379878627e-60
Description: Ribosomal protein L10
DictyBase DDB_G0286501 8.000631584680795e-59
Description: rplP0 on chromosome: 4 position 4590677 to 4591594
SGD YLR340W 2.000555387360374e-52
Description: RPP0 Conserved ribosomal protein P0 of the ribosomal stalk, which is involved in interaction between translational elongation factors and the ribosome; similar to rat P0, human P0, and E. coli L10e; phosphorylated on serine 302
WormBase WBGene00004408 1.9990449803848145e-49
Description: locus:rla-0 60S acidic ribosomal protein P0 status:Confirmed UniProt:Q93572 protein_id:CAB02098.1
Stentor Coeruleus SteCoe_5574 5.380186160021138e-32
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22052974: Klinge S, Voigts-Hoffmann F, Leibundgut M, Arpagaus S, Ban N (2011) Crystal structure of the eukaryotic 60S ribosomal subunit in complex with initiation factor 6. Science (New York, N.Y.) 334(6058):941-8

Sequences

>TTHERM_00636970(coding)
ATGCCTCCTGCTAAAGTTGACAAGAAAGCTAAGAAGGACGCTTTCATCAGAAGATTCTAC
GAATTACTTTCCAAGTACGACTCCATCGCTCTCTGTACCTTGGAAAACGTTGGTTCTTTA
CAACTCCAATAAATCAGAAGATCTCTCGGTAGCAACAACATCATGGTTATCGGAAAGAAT
ACCGTCGTTAGAAAGGCTGTCTAACTTAAGTCTGCTGATTTACCCACTGACTCCAAGTAC
GACTGGTACAGACAATTCGGTGCTCCCAAGCCCTAACTTGCTTCCTTGATTCCTCACTTA
AAGAACAAGATTGCTTACGTTTTCCACAACGACCCCATCTTCGCCTTAAAGCCCAAGATT
GAATCCTTCGTTGTTCCCGCTCCTGCTAGAGTTGGTACTGTTGCCCAAAAGGACGTCATG
ATTCCTCCTGGCCCCACTGGTATGGATCCCTCATAAATTAACTTCTTCCACGCCTTGTCT
ATCTCCACCAAGATTCAAAAGGGTCAAATTGAAATTACCAAGGAAGTCTAGGTCTGTACT
AAGGGTAAGAAGATCGGTAACTCCGAAGTTTCTCTCTTGGAAAAGATGAACATCCAACCC
TTCTCTTATGGTATGAAGTGTTTCTCTGACTACGACAACGGTGAAATCTTAACTGAAGAA
GTCTTGTCTATCAGTCCCAGCGTTATTTTGGATGCTTTCGCCCAAAACACCTTAAGAATC
GCTGCCGTCTCCCTCGCCACCGGATACGTCACTGCTCCCTCCGTTCCTCACTTCATCCAA
AATGCTTTCAAGGATCTTGCTGCCATCGGTATGGAAACTGGTTACAAGTTCAAGGAAATT
GAAAATGCTGGTCAAGCTGTTGCTGTCTCTGCTCCCGCTGCTAAGACTGAAACCAAGGCT
GCCGCTAAGCCCGTCGTTGAAGAAAAGCCTGCTGAACCCGAAGAAGATTTGGACATGGGT
GATCTTTTCGGTTGA


>TTHERM_00636970(gene)
ATGCCTCCTGCTAAAGTTGACAAGAAAGCTAAGAAGGACGCTTTCATCAGAAGATTCTAC
GAATTACTTTCCAAGTACGACTCCATCGCTCTCTGTACCTTGGAAAACGTTGGTTCTTTA
CAACTCCAATAAATCAGAAGATCTCTCGGTAGCAACAACATCATGGTTATCGGAAAGAAT
GTAAGAATTTATTTTTTTTTGTACTTATATTTTTGTATCATAAATCATCATGTTCATCTT
CAACCCTTCAACCTTCAACACTTAATTAGCACAGGTTTAATCTAAAAATTCAAAATCTTC
AAAGATGCGGACTTTCAAATTAGAAATCATAATCAAATTTATCTACTTAATAACCAGCCA
ATCTACCTTAAACTCCAATCAATCAATCAACCTACCTACCTATTAATCTATTCAAAATCA
TTAATTGATTAATAAAATACACTCTCGACATGAAAGCTTCACATAATCTTTCTCGAGCTA
AAAAATTAGCATCAAACATAAATTTCTAGTTAATTTTAAAAAGCAATGCAACATCAAATA
GATATGCTGAGTGAAAAAGCAGAATAATCGCTCTTCTCCTTCAATATGGATTGCTTACTA
AGCAAAAAATATAGCTATTAAATAGTTTTGGTAAATAGCGAAGATTAAATTATTTGTTAT
TTTTCAGAGATATTATTAGTCAAAATTAAGAAAAATATCTTGTATTAGAAAGGAGGCTAA
AAATTAAAAACAAAAGAAAGAAAGCGTGAATTATGTTGAAAAAGGAAAGATTTTTAAGAT
CATAAGGATCTTCATAGTAAATATTTATCAAAGCATGTGGTGGAAGGAATGGTAGGTAAT
AAGTTTGAAGATACAAAGGTAGAAACTTCAAAAGCGGAGTATATTTGATTAATCAATCTA
TTTGAAAGTTTCATAACAATTAAAGGATAGATGAAGCGTTTTGTAAAAAATAAGAACATT
TTAAACTAAATTAGCAAGCAAGCAGCGCATAAACCAAATATTAGGTAGAAATAACCTATC
ATTGTTTGCTTGCAGCTTAATGCAAAAATGTCTGTTAGTCCTTCGAATTTAAATTTCATT
TTTCATAGTGAAAATTATACTAAATTAATTTGTCTGACCTCATATTAAAAAACTACTTTT
ATCACCACATACATACATATAAGTAGAAGAATAAATCTGTCAACAAAATAAATAGTAAAT
AACGAGATTTTATTCTTTTGGTGAAGCCATCCATAATAATAACAAATCATTAGCTAATTA
ACTTTCGAAGGTGTTAATTATATCAAAAAATAAATAAATAAAGATAGTATGAAACAAACA
AACAATAAATCAACCATTAATAATTAATTAGACTTAACTGTAATATCTATCTATCAATCC
AAATCCAAAAATTTCTAAATAATACTTTAGAACCATAGAATCAAATATAAATTTTTAGAA
AATGTGCTAATTTAAGCATAAAACGAAGTGGTAAACTTGGTGAAGAAAGAAGATGAGCAT
TTTAGAGTTTAATTTATGAACAAAATTTTAGCAAACTATTAAAACACTTAATATATTCTT
AACCATATTTTATTTTTTTGAAAAAAAAATATTTCTACCAGCAAACAAAAATTTTAAATA
TTTATTTTAACTCAATTTCTAAATTAATTAAATAGACCGTCGTTAGAAAGGCTGTCTAAC
TTAAGTCTGCTGATTTACCCACTGACTCCAAGTACGACTGGTACAGACAATTCGGTGCTC
CCAAGCCCTAACTTGCTTCCTTGATTCCTCACTTAAAGAACAAGATTGCTTACGTTTTCC
ACAACGACCCCATCTTCGCCTTAAAGCCCAAGATTGAATCCTTCGTTGTTCCCGCTCCTG
CTAGAGTTGGTACTGTTGCCCAAAAGGACGTCATGATTCCTCCTGGCCCCACTGGTATGG
ATCCCTCATAAATTAACTTCTTCCACGCCTTGTCTATCTCCACCAAGATTCAAAAGGGTC
AAATTGAAATTACCAAGGAAGTCTAGGTCTGTACTAAGGGTAAGAAGATCGGTAACTCCG
AAGTTTCTCTCTTGGAAAAGATGAACATCCAACCCTTCTCTTATGGTATGAAGTGTTTCT
CTGACTACGACAACGGTGAAATCTTAACTGAAGAAGTCTTGTCTATCAGTCCCAGCGTTA
TTTTGGATGCTTTCGCCCAAAACACCTTAAGAATCGCTGCCGTCTCCCTCGCCACCGGAT
ACGTCACTGCTCCCTCCGTTCCTCACTTCATCCAAAATGCTTTCAAGGATCTTGCTGCCA
TCGGTATGGAAACTGGTTACAAGTTCAAGGAAATTGAAAATGCTGGTCAAGCTGTTGCTG
TCTCTGCTCCCGCTGCTAAGACTGAAACCAAGGCTGCCGCTAAGCCCGTCGGTAAGAAAA
TTTTATTTATATTACATAAAAAATTGAAATTAATAAATATTTTTAATAAATTTTAGTTGA
AGAAAAGCCTGCTGAACCCGAAGAAGATTTGGACATGGGTGATCTTTTCGGTTGA


>TTHERM_00636970(protein)
MPPAKVDKKAKKDAFIRRFYELLSKYDSIALCTLENVGSLQLQQIRRSLGSNNIMVIGKN
TVVRKAVQLKSADLPTDSKYDWYRQFGAPKPQLASLIPHLKNKIAYVFHNDPIFALKPKI
ESFVVPAPARVGTVAQKDVMIPPGPTGMDPSQINFFHALSISTKIQKGQIEITKEVQVCT
KGKKIGNSEVSLLEKMNIQPFSYGMKCFSDYDNGEILTEEVLSISPSVILDAFAQNTLRI
AAVSLATGYVTAPSVPHFIQNAFKDLAAIGMETGYKFKEIENAGQAVAVSAPAAKTETKA
AAKPVVEEKPAEPEEDLDMGDLFG