Identifiers and Description

Gene Model Identifier

TTHERM_00637100

Standard Name

MRNO53 (Membrane Occupation and Recognition Nexus protein other)

Aliases

PreTt19713 | 91.m00128 | RSK1

Description

RSK1 protein kinase; Protein with predicted MORN domains localized throughout the protein and/or associated with other domains having a predicted function. Protein kinase domain containing protein.

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_10026.1 9.997093137033517e-262
Description: hypothetical protein (754 aa)
Oxytricha Contig16869.0.g26 2.000214949834694e-50
Description: MORN repeat
Stentor Coeruleus SteCoe_21310 3.6251409191435593e-34
Description: None
WormBase WBGene00020142 5.0000961330688895e-23
Description: locus:aak-2 5-AMP-activated protein kinase catalytic subunit alpha-2 status:Confirmed UniProt:Q95ZQ4 protein_id:CCD68834.1
DictyBase DDB_G0269152 1.9991095569230066e-20
Description: mekA on chromosome: 1 position 4015409 to 4017699
SGD YPL153C 4.001630327199692e-20
Description: RAD53 Protein kinase, required for cell-cycle arrest in response to DNA damage; activated by trans autophosphorylation when interacting with hyperphosphorylated Rad9p; also interacts with ARS1 and plays a role in initiation of DNA replication

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00637100(coding)
ATGTAAAACAAAGAAGTTTAAAAGCTAAGCAAAGAGGAAATCAAAGATTTTTTGCAAAGT
AAATAAAGTTATATAACTTCTAACTAAATTTAGCAATCTATAAACTTTCTATCATAATAT
GGCTACCTTGTAGTTTAATTGATAGATTCTGGAAGTTTCGGTGTTGTTATGAAAGCTATT
GATTCTTCGAATAGCAAAAGATATGTAGCTATAAAGATTATCATTGTAACAAATGCTGAT
ATTTTAAAAGAAAATATTTAAGAATATTAGAAATGCCTTTTAATTAATCATCCCAACGTC
ATCAAAAGTTATTAGCAGCTTTACGATGAAGACAATGAATGCTTTTTTATCATTTCAGAG
TTTTGTTAAAAAGGTAATCTGTTTAACTTTTTTAAACAAAACGATATTAAAAAAGAAGAA
ATCGTTGAAATTTGTACTTAAATTATTGAAGGTGTTTTAGCTATTCATGATAAAAATATT
ATACACAGCGACTTAAAGCCTTAAAATATTCTTATCAATGATGATGATAAAATAAAAATA
TGTGATTTAGGAATGTCTAAATAACTCTTAGGATCTAAATCTCACACTATTTCAAAAGGT
GGAAGTTTGGATTATATGTCCCCAGAATAAATTGAAGGTAAACTTAGTAAATAATCTGAT
ATTTACTCAGTAGGATGTATTATTTGCTTTCTTTGTAATATAAACATATTTGGTTTGAAT
ATGATTAATATAAAGAAAGGGATATTTCCTTCTATTTAAGAAAACCCGTGTAAAGAGTTA
GTTAATTTAGCTTTTCAAATGATGAGCGTAGAACCTAAAAATAGAATTCATCTTCAATTT
TGTTTAGATGAATTGAAATAGTTTGAGAAGAGTAACTCAGACAATCAAAAAGGATAAATT
GTTGTAAAATAGTTTTAAAATGGTGATAGGTACTAAGGTGAAATGAAAGAGGGAAAGATG
AATGGAAAAGGAATTTACTTTTATAGCGAATAAAAGATTATAAAAAAATATGAAGGTGAT
TGGGTTAATGATTAGAAAGAAGGTAATGGTACTTTAGAATACTGGAATGGAGATCAATAT
GAAGGAAATTTTAAAAATGATTAAAGAAGTGGTAAAGGAATACTTTATTTTAGTGAAGTA
AATATCTCAAAGAAATACGAAGGTGAATGGGTAAATGATAAATTTGAAGGTTTTGGAATT
TTAGAATTTAGAGATGGTAACATGTATAAAGGATAGTTCTAAAATGGTAGTTTTAATGGA
GAAGGAATAGAGTATTTGAATGGAGATAAATATGAAGGAAATTTCAAAAATGGTTAAAGA
AGCGGCAAAGGAATACTTTATTATAGTGAAACAAGTATCTTAAAGAAATACAAAGGTGAA
TGGGTAAATGATAAATTTGAAGGTTTTGGAATTTTAGAATTTAGAAACGGTGATATATAT
GAAGGATAGTTCTCAAACTATATTTTTAATGGAAAAGGAATTTATTTTTATAGTGATAAT
GCCTTTAGAAAAAAATATGAAGGTGAATGGGTAAATGATAAATTTGAAGGTTTTGGAATT
TTAGAATTTAGAAATGGTGATAAGTATGAAGGATAGTTCTAAAATGGTAGTTTTAATGGA
AAAGGAAAATAATATTTGAATGGAGATAAATATGAAGGAAATTTCAAAAATGGTTAAAAA
AGTGGTAACGGAATACTTTATTATAGTGAAGCAAATACCTTAAAGAAATACGAAGGTGAA
TGGGCAAATGATAAATTTGAAGGTTTTGGAATTTTAGAATTTAGGAACGGTGACATGTAT
GAAGGGTAGTTCTAAAACTATATTTTTAATGGAAAAGGAATTTATTTTTATAGTGAAAAT
GACATTAGAAAAAAATATGAAGGTTATTGGGTTAATGACAAGAAAGAAGGCCAAGGTACT
TTAGAATACTGGAATGGAGATAAATATAAAGGAAATTTCAAAAATGATTAAAGAAGTGGT
TAAGGAATACTTTATTATAATGAAGCAAATATCTCAAAGAAATACGAAGGTGAATGGGCA
AATGATAAATTTGAAGGTTTTGGAATTTTAGAATTTAGAAATGGTAATAAGTATGAAGGA
TAGTTCTAAAATGGTAGTTTTAATGGAAAAGGAATAGAATATTTGAATGGAGATAAATAT
GAAGGAAATTTCAAAAATGGTTAAAAAATTGGCAAAGGAATACTTTATTACAGTGAAACA
AGTATCTTAAAGAAATACGAAGGTGAATGGGTAAATGATAAATTTGAAGGTTTTGGAATT
TTAGAGTATAGAAAAGGTGATATGTATGAAGGATAATTCTAAAATGGTAGTTTTAATGGA
AAAGGTATTTATTTTTATAGTGAAAATGACATTAGAAAAAAATATGAAGGCTATTGGGTT
AAAGGTAAGAAAGAAGGCAAAGGTACTTTAGAATACTGGAATGGAGATAAATATGAAGGA
AACTTTAAAAATGATGAAATAAGTGGTAAGTGA


>TTHERM_00637100(gene)
ATGTAAAACAAAGAAGTTTAAAAGCTAAGCAAAGAGGAAATCAAAGATTTTTTGCAAAGT
AAATAAAGTTATATAACTTCTAACTAAATTTAGCAATCTATAAACTTTCTATCATAATAT
GGCTACCTTGTAGTTTAATTGATAGATTCTGGAAGTTTCGGTGTTGTTATGAAAGCTATT
GATTCTTCGAATAGCAAAAGATATGTAGCTATAAAGATTATCATTGTAACAAATGCTGAT
ATTTTAAAAGAAAATATTTAAGAATATTAGAAATGCCTTTTAATTAATCATCCCAACGTC
ATCAAAAGTTATTAGCAGCTTTACGATGAAGACAATGAATGCTTTTTTATCATTTCAGAG
TTTTGTTAAAAAGGTAATCTGTTTAACTTTTTTAAACAAAACGATATTAAAAAAGAAGAA
ATCGTTGAAATTTGTACTTAAATTATTGAAGGTGTTTTAGCTATTCATGATAAAAATATT
ATACACAGCGACTTAAAGCCTTAAAATATTCTTATCAATGATGATGATAAAATAAAAATA
TGTGATTTAGGAATGTCTAAATAACTCTTAGGATCTAAATCTCACACTATTTCAAAAGGT
GGAAGTTTGGATTATATGTCCCCAGAATAAATTGAAGGTAAACTTAGTAAATAATCTGAT
ATTTACTCAGTAGGATGTATTATTTGCTTTCTTTGTAATATAAACATATTTGGTTTGAAT
ATGATTAATATAAAGAAAGGGATATTTCCTTCTATTTAAGAAAACCCGTGTAAAGAGTTA
GTTAATTTAGCTTTTCAAATGATGAGCGTAGAACCTAAAAATAGAATTCATCTTCAATTT
TGTTTAGATGAATTGAAATAGTTTGAGAAGAGTAACTCAGACAATCAAAAAGGATAAATT
GTTGTAAAATAGTTTTAAAATGGTGATAGGTACTAAGGTGAAATGAAAGAGGGAAAGATG
AATGGAAAAGGAATTTACTTTTATAGCGAATAAAAGATTATAAAAAAATATGAAGGTGAT
TGGGTTAATGATTAGAAAGAAGGTAATGGTACTTTAGAATACTGGAATGGAGATCAATAT
GAAGGAAATTTTAAAAATGATTAAAGAAGTGGTAAAGGAATACTTTATTTTAGTGAAGTA
AATATCTCAAAGAAATACGAAGGTGAATGGGTAAATGATAAATTTGAAGGTTTTGGAATT
TTAGAATTTAGAGATGGTAACATGTATAAAGGATAGTTCTAAAATGGTAGTTTTAATGGA
GAAGGAATAGAGTATTTGAATGGAGATAAATATGAAGGAAATTTCAAAAATGGTTAAAGA
AGCGGCAAAGGAATACTTTATTATAGTGAAACAAGTATCTTAAAGAAATACAAAGGTGAA
TGGGTAAATGATAAATTTGAAGGTTTTGGAATTTTAGAATTTAGAAACGGTGATATATAT
GAAGGATAGTTCTCAAACTATATTTTTAATGGAAAAGGAATTTATTTTTATAGTGATAAT
GCCTTTAGAAAAAAATATGAAGGTGAATGGGTAAATGATAAATTTGAAGGTTTTGGAATT
TTAGAATTTAGAAATGGTGATAAGTATGAAGGATAGTTCTAAAATGGTAGTTTTAATGGA
AAAGGAAAATAATATTTGAATGGAGATAAATATGAAGGAAATTTCAAAAATGGTTAAAAA
AGTGGTAACGGAATACTTTATTATAGTGAAGCAAATACCTTAAAGAAATACGAAGGTGAA
TGGGCAAATGATAAATTTGAAGGTTTTGGAATTTTAGAATTTAGGAACGGTGACATGTAT
GAAGGGTAGTTCTAAAACTATATTTTTAATGGAAAAGGAATTTATTTTTATAGTGAAAAT
GACATTAGAAAAAAATATGAAGGTTATTGGGTTAATGACAAGAAAGAAGGCCAAGGTACT
TTAGAATACTGGAATGGAGATAAATATAAAGGAAATTTCAAAAATGATTAAAGAAGTGGT
TAAGGAATACTTTATTATAATGAAGCAAATATCTCAAAGAAATACGAAGGTGAATGGGCA
AATGATAAATTTGAAGGTTTTGGAATTTTAGAATTTAGAAATGGTAATAAGTATGAAGGA
TAGTTCTAAAATGGTAGTTTTAATGGAAAAGGAATAGAATATTTGAATGGAGATAAATAT
GAAGGAAATTTCAAAAATGGTTAAAAAATTGGCAAAGGAATACTTTATTACAGTGAAACA
AGTATCTTAAAGAAATACGAAGGTGAATGGGTAAATGATAAATTTGAAGGTTTTGGAATT
TTAGAGTATAGAAAAGGTGATATGTATGAAGGATAATTCTAAAATGGTAGTTTTAATGGA
AAAGGTATTTATTTTTATAGTGAAAATGACATTAGAAAAAAATATGAAGGCTATTGGGTT
AAAGGTAAGAAAGAAGGCAAAGGTACTTTAGAATACTGGAATGGAGATAAATATGAAGGA
AACTTTAAAAATGATGAAATAAGTGGTAAGTGA


>TTHERM_00637100(protein)
MQNKEVQKLSKEEIKDFLQSKQSYITSNQIQQSINFLSQYGYLVVQLIDSGSFGVVMKAI
DSSNSKRYVAIKIIIVTNADILKENIQEYQKCLLINHPNVIKSYQQLYDEDNECFFIISE
FCQKGNLFNFFKQNDIKKEEIVEICTQIIEGVLAIHDKNIIHSDLKPQNILINDDDKIKI
CDLGMSKQLLGSKSHTISKGGSLDYMSPEQIEGKLSKQSDIYSVGCIICFLCNINIFGLN
MINIKKGIFPSIQENPCKELVNLAFQMMSVEPKNRIHLQFCLDELKQFEKSNSDNQKGQI
VVKQFQNGDRYQGEMKEGKMNGKGIYFYSEQKIIKKYEGDWVNDQKEGNGTLEYWNGDQY
EGNFKNDQRSGKGILYFSEVNISKKYEGEWVNDKFEGFGILEFRDGNMYKGQFQNGSFNG
EGIEYLNGDKYEGNFKNGQRSGKGILYYSETSILKKYKGEWVNDKFEGFGILEFRNGDIY
EGQFSNYIFNGKGIYFYSDNAFRKKYEGEWVNDKFEGFGILEFRNGDKYEGQFQNGSFNG
KGKQYLNGDKYEGNFKNGQKSGNGILYYSEANTLKKYEGEWANDKFEGFGILEFRNGDMY
EGQFQNYIFNGKGIYFYSENDIRKKYEGYWVNDKKEGQGTLEYWNGDKYKGNFKNDQRSG
QGILYYNEANISKKYEGEWANDKFEGFGILEFRNGNKYEGQFQNGSFNGKGIEYLNGDKY
EGNFKNGQKIGKGILYYSETSILKKYEGEWVNDKFEGFGILEYRKGDMYEGQFQNGSFNG
KGIYFYSENDIRKKYEGYWVKGKKEGKGTLEYWNGDKYEGNFKNDEISGK