Identifiers and Description

Gene Model Identifier

TTHERM_00637110

Standard Name

MRNO41 (Membrane Occupation and Recognition Nexus protein other)

Aliases

PreTt19714 | 91.m00129

Description

protein kinase; Protein with predicted MORN domains localized throughout the protein and/or associated with other domains having a predicted function. Protein kinase domain containing protein.

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_18802.1 1.000008670162283e-147
Description: hypothetical protein (1043 aa)
Oxytricha Contig728.0.g23 3.998097515166115e-39
Description: MORN repeat
WormBase WBGene00020142 4.998021988471165e-24
Description: locus:aak-2 5-AMP-activated protein kinase catalytic subunit alpha-2 status:Confirmed UniProt:Q95ZQ4 protein_id:CCD68834.1
DictyBase DDB_G0270814 9.998720540547892e-23
Description: nek2 on chromosome: 1 position 4847143 to 4848761
SGD YDR507C 3.999970367130025e-21
Description: GIN4 Protein kinase involved in bud growth and assembly of the septin ring, proposed to have kinase-dependent and kinase-independent activities; undergoes autophosphorylation; similar to Kcc4p and Hsl1p
Stentor Coeruleus SteCoe_21310 8.533047625744066e-17
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00637110(coding)
ATGTAAAACAAAGAAGTTTAGAAGCTAAGCAAAGAGGAAATCAAAGATTTTTTGCAAAGT
AAATAAAGTTAAATAACTTCTAACTAAATTTAGCAATCTATAAACTTTCTATCATAATAT
GGCTACCATGTAGTTTAATTGATAGATTCTGGAAGTTTTGGTATTGTTATGAAAGCTATT
GATTCTTCGAATAGCAAAAGATATGTAGCAATAAAGCTTATCATAGTAACAAATACTGAA
ATTTTAAAAGAAAACATTTAAGAATATTAGAAATGCCTTTTAATTAATCATCCCAACGTC
ATCAAAAATTATTAGTAGCTTTATGATGAAGAGAATGAATGCTTTTTTATCATTACAGAG
TTTTGTTAAAAAGGTAATCTGTTTAACTTTTTTAAACAAAACAATATTAAAAAAGAAGAA
ATTGTTGAAATTTGTGCTTAAATTATTGAAGGTGTTTTAGCTATTCATGATAAAAATATT
ATACACAGCGACTTAAAGCCTTAAAATATTCTTATCAATGATGATGATAAAATAAAAATA
TGTGATTTAGGAATGTCTAAATAACTTTTAGGATCAAAATCTCACACCATTTCCAAAGGT
GGAAGTTTGGATTATATGTCACCAGAATAAATTGAAGGTAAGATTAGTAAATAATCTGAC
ATATATTCAGTTGGATGTATTATTTGCTTTCTTTGTAATGTTAACATATTTGGTTTGAAT
ATGGTTAATATAAAGAAAGGGATATTTCCTCCTATATAGGAAAATTGCTTTAAAGAGTTA
GTTAATTTAGCTTTTAAAATGATGAGTGTAGAGCCTAAAAATAGAATTTAGCTTCAAGAT
TCTTTAGATTAGTTGAAATAGTTTTAGAAGATTAACTCACACAATCAAAAAGGAGAAATT
GTTGTAAAATAGTTTTAAAATGGTGATAGATACGAAGGTGAAGTGAAAGATGGAAAGATG
AATGGAAAAGGGATCTACTACTATAAAGAAGATAATATAAGAAAGAAGTATGAAGGATAG
TGGGTTAATGATAAAAAGGATGGCTTTGGTATTTTGGAATATAAAAGTGGGAATAAGTAT
GAAGGATACTTCAAAAACGATTGTTTTAATGGAAAGGGAATTTACTACTATTATAAAGAA
GGTGATAATAAAATGAAGTATGAAGGATAGTGGGTTAATAATCAAAAAGATGGCTTTGGT
ATTTTGGAATATAAAAGTGGGAATAAGTATGAAGGATAATTCAAAAATGATGATTTTAAT
GGAAAGGGAATCTACTACTATAAACAAGGCGACAATATAAAGAAGTATGAAGGATAGTGG
GCTAGTAATTAAAAAGATGGCTTTGGAATTATGGAATATAAAAATGGGAATAGGTATGAA
GGGTAGTTTAAAAATGGTGAATTTAATGGAAAGGGAATCTTCTACTATAAAGAAGATGAT
ATTAAAAAGAGCTATGATGGATTATGGGTTAATGATAAATAGGAAGGCTTTGGAATTTTA
GAGTATAAAAATGGTACTAAATATGAAGGAAACTTCAAGAATGGGAAAAAGAATGGAAAA
GGAATCTAATTAGATTAAAATGGTTAAAAACTTAATGGTGAGTGGATTGATGATAAATTT
TAAACTAATTGA


>TTHERM_00637110(gene)
ATGTAAAACAAAGAAGTTTAGAAGCTAAGCAAAGAGGAAATCAAAGATTTTTTGCAAAGT
AAATAAAGTTAAATAACTTCTAACTAAATTTAGCAATCTATAAACTTTCTATCATAATAT
GGCTACCATGTAGTTTAATTGATAGATTCTGGAAGTTTTGGTATTGTTATGAAAGCTATT
GATTCTTCGAATAGCAAAAGATATGTAGCAATAAAGCTTATCATAGTAACAAATACTGAA
ATTTTAAAAGAAAACATTTAAGAATATTAGAAATGCCTTTTAATTAATCATCCCAACGTC
ATCAAAAATTATTAGTAGCTTTATGATGAAGAGAATGAATGCTTTTTTATCATTACAGAG
TTTTGTTAAAAAGGTAATCTGTTTAACTTTTTTAAACAAAACAATATTAAAAAAGAAGAA
ATTGTTGAAATTTGTGCTTAAATTATTGAAGGTGTTTTAGCTATTCATGATAAAAATATT
ATACACAGCGACTTAAAGCCTTAAAATATTCTTATCAATGATGATGATAAAATAAAAATA
TGTGATTTAGGAATGTCTAAATAACTTTTAGGATCAAAATCTCACACCATTTCCAAAGGT
GGAAGTTTGGATTATATGTCACCAGAATAAATTGAAGGTAAGATTAGTAAATAATCTGAC
ATATATTCAGTTGGATGTATTATTTGCTTTCTTTGTAATGTTAACATATTTGGTTTGAAT
ATGGTTAATATAAAGAAAGGGATATTTCCTCCTATATAGGAAAATTGCTTTAAAGAGTTA
GTTAATTTAGCTTTTAAAATGATGAGTGTAGAGCCTAAAAATAGAATTTAGCTTCAAGAT
TCTTTAGATTAGTTGAAATAGTTTTAGAAGATTAACTCACACAATCAAAAAGGAGAAATT
GTTGTAAAATAGTTTTAAAATGGTGATAGATACGAAGGTGAAGTGAAAGATGGAAAGATG
AATGGAAAAGGGATCTACTACTATAAAGAAGATAATATAAGAAAGAAGTATGAAGGATAG
TGGGTTAATGATAAAAAGGATGGCTTTGGTATTTTGGAATATAAAAGTGGGAATAAGTAT
GAAGGATACTTCAAAAACGATTGTTTTAATGGAAAGGGAATTTACTACTATTATAAAGAA
GGTGATAATAAAATGAAGTATGAAGGATAGTGGGTTAATAATCAAAAAGATGGCTTTGGT
ATTTTGGAATATAAAAGTGGGAATAAGTATGAAGGATAATTCAAAAATGATGATTTTAAT
GGAAAGGGAATCTACTACTATAAACAAGGCGACAATATAAAGAAGTATGAAGGATAGTGG
GCTAGTAATTAAAAAGATGGCTTTGGAATTATGGAATATAAAAATGGGAATAGGTATGAA
GGGTAGTTTAAAAATGGTGAATTTAATGGAAAGGGAATCTTCTACTATAAAGAAGATGAT
ATTAAAAAGAGCTATGATGGATTATGGGTTAATGATAAATAGGAAGGCTTTGGAATTTTA
GAGTATAAAAATGGTACTAAATATGAAGGAAACTTCAAGAATGGGAAAAAGAATGGAAAA
GGAATCTAATTAGATTAAAATGGTTAAAAACTTAATGGTGAGTGGATTGATGATAAATTT
TAAACTAATTGA


>TTHERM_00637110(protein)
MQNKEVQKLSKEEIKDFLQSKQSQITSNQIQQSINFLSQYGYHVVQLIDSGSFGIVMKAI
DSSNSKRYVAIKLIIVTNTEILKENIQEYQKCLLINHPNVIKNYQQLYDEENECFFIITE
FCQKGNLFNFFKQNNIKKEEIVEICAQIIEGVLAIHDKNIIHSDLKPQNILINDDDKIKI
CDLGMSKQLLGSKSHTISKGGSLDYMSPEQIEGKISKQSDIYSVGCIICFLCNVNIFGLN
MVNIKKGIFPPIQENCFKELVNLAFKMMSVEPKNRIQLQDSLDQLKQFQKINSHNQKGEI
VVKQFQNGDRYEGEVKDGKMNGKGIYYYKEDNIRKKYEGQWVNDKKDGFGILEYKSGNKY
EGYFKNDCFNGKGIYYYYKEGDNKMKYEGQWVNNQKDGFGILEYKSGNKYEGQFKNDDFN
GKGIYYYKQGDNIKKYEGQWASNQKDGFGIMEYKNGNRYEGQFKNGEFNGKGIFYYKEDD
IKKSYDGLWVNDKQEGFGILEYKNGTKYEGNFKNGKKNGKGIQLDQNGQKLNGEWIDDKF
QTN