Identifiers and Description

Gene Model Identifier

TTHERM_00641080

Standard Name

IRE1 (Inositol REquiring)

Aliases

PreTt10577 | 92.m00119

Description

Serine/Threonine kinase domain protein; Homolog of yeast IRE1; Protein kinase domain containing protein. Sequence similarity to the IRE protein kinase family (Eisen et al.- 2006).

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00069 ) protein kinase domain
  • ( PF04383 ) KilA-N domain
  • ( PF05316 ) Mitochondrial ribosomal protein (VAR1)
  • ( PF06479 ) Ribonuclease 2-5A
  • ( PF07714 ) protein tyrosine kinase

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_05206.1 9.997093137033517e-262
Description: protein kinase domain-containing protein (920 aa)
WormBase WBGene00002147 1.9997677415930956e-65
Description: locus:ire-1 status:Partially_confirmed UniProt:E5QCG0 protein_id:CBY24252.1
DictyBase DDB_G0267650 6.996751372006089e-64
Description: ireA on chromosome: 1 position 495110 to 498317
SGD YHR079C 6.996751372006089e-64
Description: IRE1 Serine-threonine kinase and endoribonuclease; transmembrane protein that mediates the unfolded protein response (UPR) by regulating Hac1p synthesis through HAC1 mRNA splicing; Kar2p binds inactive Ire1p and releases from it upon ER stress
Oxytricha Contig237.1.g129 3.999925618735366e-62
Description: Protein kinase domain
Stentor Coeruleus SteCoe_9478 1.462486227251231e-31
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00641080(coding)
ATGATAATCTATTTCAATAGTTTTTTTAAGAAATTTGTTTAAAATTAAAAGTAAATAAGA
TTTATACTGCCTTATTTCATCATTAAGTTTATATAAATTATTAATACAAAATAAAACATG
AATAACTTTTAAAATTTCTTCAAAAAGTAAAAAAAACTTATTGCCATTTTTATATTACTT
TTATTAATAAATGGCACTTTAGCTTAGCATAGCAATAAAAAAAGCTAGACTCAGAATAAT
AGTTCTGAGACGGCTTTAACTCATTCTAAAGTAGACAAAGATGCCTATCTAGTATTAACT
AATGATGGCAAATTATATAGCTATAATATAAAGAAAAAGTTGTTAAATTGGATGACAGAT
CTGAAAGTAGTTGTTAGCGAGCTCAAATTCAATAACGAAAAACAATAGTAGGATAATTAT
GGAATGGAAGATCAGCACTCTACTGAACTCTCTATTGCAGGAAATTAGGAATCTAACTTT
GAGAGATACGACTATTTTTTGCCCTCTTCTGATGGAAATTTTATCTTTTTAGCATCAGAT
TCTACTCCAATAAAAATTATGCGAGATGAAATAGACCAAGTTATTAAAATATGTCCAATG
AGTGGAAACGAGTCAAAATATATTGCATTTACCAAAGAAAAGATTCTTTTAGTCAATCCT
GAAAATGGGGAATTAGAGAAATTTGAAGATATTGAAGATGATTATGAAAACTATTTAAAT
CATTATATTATCAATATCAACTAGAAACTTATTAAGCAACTTAATATTTTTACCAAAAGA
GAAAATTGGGCTTTAACCAGCACAGATGTTAATTTGATGATTTATGAAGACTTTTTATAC
AAAGGATTATAAAAAAATCAGCTTACTGAAAATGAGGATTATATTTTTATGTAAGATTAG
CATTAAGATTTGAAAATTAAGCAAAAGCAATCAAAGATTAAAATAGTTGATTTCTAAACA
GATTAGGAAATTATTGCTATTTTTTCTGCAGTTGGATTTACAAACATGTTTTAAAAGAAT
GTCATAGTGCATAATCCTCTTATCAATACGTTCATATCTTCAGAATATGATAACACATAG
ATTTAAATAGGTGGAGAGAAAGGCATAGTTTCGTTTAATGAAGGGAGCAACTTTTAGCTA
ATACCATTGTAGATTTCTACAAAGCTAAAGAATTAGTGTTTAGAAAATAAGTAATGCAGA
GAAAGATTGATTTTTAGTGTTGATAAATTTGATGATAAAAATTATATCAGAGATGTTATG
ACTTGCATAGATAACCTCAGAAAGGGGAGAATGATGATTGAAGTTATATCTGATAGTAAG
GATATCTAGAATGCCAGCAATATTCCTAGTTAAGCATTCAATTTTGCTAAGGATAATAAA
ATTACAATATTCTTGCTGACATTCTTAATTATCTTGGTTATTATTCTGATTTTAAAAGAT
GAAAGAATTACTTCTATGTATAAAAGAAATAGTGGTCGTTCTGGAGGTAAATCTTCCAGT
TAAAAATAAAACTCCCAAGAAGAAGCTGATAAAGTCTTAGAAAAAATTAGCAAAGAGCAA
GAAGAAGAAATTAAAAAACAAAATGAGCAAAATAATAAATAAGAAAAAAAGAACCAAGAG
AGTAGCGAATAAAATGCAAATAAATTTAAAGGGCTTTAAATTAATAGAAATAAAGTTTTA
GGGTATGGGGCTTAAGGGACAGTTATTTTTGAAGGAACATTTTAAGGAAGAGAAATTGCA
GTCAAATAGTTACTTAAAGATAATAAAGACTTAGCTAGCAAGGAAATATAAATGTTGATT
AAGCTGCAACACAAAAATATAATTAAGTACTACTATTTTGAGGAAACAAAAGATCACATA
CTTCTTGGACTAGAAAAGTGTGTTGGAAGCATTAGCGATTTAATAGATTATGCAAATAGA
AAAAACAAGAAGAAAAGTGAGTAGGATTTGAAAGCTTTATATAATATAAAAACGGATTTT
TTCATTAAGTCAACTATGAAAAATACATTTAAAGACTGCTTAGAAGGATTGAGTTATTTG
CATAGCTAAGGTGTTATTCATAGAGATATAAAGCCAGAAAATATTTTAATTCACTACAAC
AAAGAAATTAAATTAGCTGATTTTGGACTTTCAAAGAATATTTCTAAAACGAATGTCATA
TTCACGAATGATATCGGCACATGGGGATGGAGACCACTAGAATAAATAGATAATTAACCA
CTTACATATAATACAGATGTTTTCTCTCTTGGCTGTGTATTCTATTACATATACACTTAA
GGAGGTCATCCTTTTGGAGAATAGAAAGAAAGGGAAAGAAACATAGCTAATTTTAAGTAC
AGCTTGAGAATGGAAGATGAAACCTTGAAAGACCTTATCCAAAAAATGATTCATAATGAT
CAAAGTAAAAGACTGACTGTAAAAGAATGCTTAAAGCATCCATATTTCTGGAATACCTTG
TAAAAGTTCTCTTTTATTTGCGAATTTAGTGACTACATAGAAACATTTGATACTGAAAAT
AAATATTCAGACTTGATTGAATAATAAGCAAAGTCTTTGAATGTTTTAGAAGGAAATAGA
TGGGATAAAAATGTAGATAAAAGTCTTATTTAAGATACTAAAGTGTTTAAATTCTACAAC
TATGGATAGGTTAAAGATCTTATCAGATTAATAAGGAACAGAAAAAGTCATTATCACGAG
CTTTCAGAGAGCTCTAAAGATATAGTAGGAGATACTCTTGATGATATGTTTAACTATTTT
GATGAAAGATTCCCTAAATTATTTATTTTTATGTATTATTTCTCACAAACTTAAAACTGG
GAATTACTAAGCTTTAAAAATAACTGA


>TTHERM_00641080(gene)
ATGATAATCTATTTCAATAGTTTTTTTAAGAAATTTGTTTAAAATTAAAAGTAAATAAGA
TTTATACTGCCTTATTTCATCATTAAGTTTATATAAATTATTAATACAAAATAAAACATG
AATAACTTTTAAAATTTCTTCAAAAAGTAAAAAAAACTTATTGCCATTTTTATATTACTT
TTATTAATAAATGGCACTTTAGCTTAGCATAGCAATAAAAAAAGCTAGACTCAGAATAAT
AGTTCTGAGACGGCTTTAACTCATTCTAAAGTAGACAAAGATGCCTATCTAGTATATCAT
TTATTTCATTCATCATTATTGTTGTTGTTTTAACTTTATAAGCCATAACAAATTTAAATT
TTATTTGATAGGTATTAACTAATGATGGCAAATTATATAGCTATAATATAAAGAAAAAGT
TGTTAAATTGGATGACAGATCTGAAAGTAGTTGTTAGCGAGCTCAAATTCAATAACGAAA
AACAATAGTAGGATAATTATGGAATGGAAGATCAGCACTCTACTGAACTCTCTATTGCAG
GAAATTAGGAATCTAACTTTGAGAGATACGACTATTTTTTGCCCTCTTCTGATGGAAATT
TTATCTTTTTAGCATCAGATTCTACTCCAATAGTACATACACAATAAACAAATAATTGAT
TAAATTTAAAATAAATATCATTATTTTTAGAAAATTATGCGAGATGAAATAGACCAAGTT
ATTAAAATATGTCCAATGAGTGGAAACGAGTCAAAATATATTGCATTTACCAAAGAAAAG
ATTCTTTTAGTCAATCCTGAAAATGGGGAATTAGAGAAATTTGAAGATATTGAAGATGAT
TATGAAAACTATTTAAATCATTATATTATCAATATCAACTAGAAACTTATTAAGCAACTT
AATATTTTTACCAAAAGAGAAAATTGGGCTTTAACCAGCACAGATGTTAATTTGATGATT
TATGAAGACTTTTTATACAAAGGATTATAAAAAAATCAGCTTACTGAAAATGAGGATTAT
ATTTTTATGTAAGATTAGCATTAAGATTTGAAAATTAAGCAAAAGCAATCAAAGATTAAA
ATAGTTGATTTCTAAACAGATTAGGAAATTATTGCTATTTTTTCTGCAGTTGGATTTACA
AACATGTTTTAAAAGAATGTCATAGTGCATAATCCTCTTATCAATACGTTCATATCTTCA
GAATATGTAAGATTTATTTATTGATTTTTTGTTGTTAAATTAAAATTTATTTTTTTTTAT
CAAGGATAACACATAGATTTAAATAGGTGGAGAGAAAGGCATAGTTTCGTTTAATGAAGG
GAGCAACTTTTAGCTAATACCATTGTAGATTTCTACAAAGCTAAAGAATTAGTGTTTAGA
AAATAAGTAATGCAGAGAAAGATTGATTTTTAGTGTTGATAAATTTGATGATAAAAATTA
TATCAGAGATGTTATGACTTGCATAGATAACCTCAGAAAGGGGAGAATGATGATTGAAGT
TATATCTGATAGTAAGGATATCTAGAATGCCAGCAATATTCCTAGTTAAGCATTCAATTT
TGCTAAGGATAATAAAATTACAATATTCTTGCTGACATTCTTAATTATCTTGGTTATTAT
TCTGATTTTAAAAGATGAAAGAATTACTTCTATGTATAAAAGAAATAGTGGTCGTTCTGG
AGGTAAATCTTCCAGTTAAAAATAAAACTCCCAAGAAGAAGCTGATAAAGTCTTAGAAAA
AATTAGCAAAGAGCAAGAAGAAGAAATTAAAAAACAAAATGAGCAAAATAATAAATAAGA
AAAAAAGAACCAAGAGAGTAGCGAATAAAATGCAAATAAATTTAAAGGGCTTTAAATTAA
TAGAAATAAAGTTTTAGGGTATGGGGCTTAAGGGACAGTTATTTTTGAAGGAACATTTTA
AGGTAATATTTAAGAATAAAAAATAGTTTTTGATTTAATAAATATTGTTTATGTGAATAT
AGGAAGAGAAATTGCAGTCAAATAGTTACTTAAAGATAATAAAGACTTAGCTAGCAAGGA
AATATAAATGTTGATTAAGCTGCAACACAAAAATATAATTAAGTACTACTATTTTGAGGA
AACAAAAGATCACATACTTCTTGGACTAGAAAAGTGTGTTGGAAGCATTAGCGATTTAAT
AGATTATGCAAATAGAAAAAACAAGAAGAAAAGTGAGTAGGATTTGAAAGCTTTATATAA
TATAAAAACGGATTTTTTCATTAAGTCAACTATGAAAAATACATTTAAAGACTGCTTAGA
AGGATTGAGTTATTTGCATAGCTAAGGTGTTATTCATAGAGATATAAAGCCAGAAAATAT
TTTAATTCACTACAACAAAGAAATTAAATTAGCTGATTTTGGACTTTCAAAGAATATTTC
TAAAACGAATGTCATATTCACGAATGATATCGGCACATGGGGATGGAGACCACTAGAATA
AATAGATAATTAACCACTTACATATAATACAGATGTTTTCTCTCTTGGCTGTGTATTCTA
TTACATATACACTTAAGGAGGTCATCCTTTTGGAGAATAGTAATTTCATAACATTAAAAA
AATAGAAAATTAAGAAATAATGTTTAAAAAAATAAATAGGAAAGAAAGGGAAAGAAACAT
AGCTAATTTTAAGTACAGCTTGAGAATGGAAGATGAAACCTTGAAAGACCTTATCCAAAA
AATGATTCATAATGATCAAAGTAAAAGACTGACTGTAAAAGAATGCTTAAAGCATCCATA
TTTCTGGAATACCTTGTAAAAGTTCTCTTTTATTTGCGAATTTAGTGACTACATAGAAAC
ATTTGGTAACTTTAAATCAAAATATTTACTTTTATATTTTAGTGAATATTGATAATTGTA
ATAAATTTAGATACTGAAAATAAATATTCAGACTTGATTGAATAATAAGCAAAGTCTTTG
AATGTTTTAGAAGGAAATAGATGGGATAAAAATGTAGATAAAAGTCTTATTTAAGATACT
AAAGTGTTTAAATTCTACAACTATGGATAGGTTAAAGATCTTATCAGAGTAAATTTTTCA
AATAAGATTTTTTTTAATAATGAATTTTTTAAATAGTTAATAAGGAACAGAAAAAGTCAT
TATCACGAGCTTTCAGAGAGCTCTAAAGATATAGTAGGAGATACTCTTGATGATATGTTT
AACTATTTTGATGAAAGATTCCCTAAATTATTTATTTTTATGTATTATTTCTCACAAACT
TAAAACTGGGAATTACTAAGCTTTAAAAATAACTGA


>TTHERM_00641080(protein)
MIIYFNSFFKKFVQNQKQIRFILPYFIIKFIQIINTKQNMNNFQNFFKKQKKLIAIFILL
LLINGTLAQHSNKKSQTQNNSSETALTHSKVDKDAYLVLTNDGKLYSYNIKKKLLNWMTD
LKVVVSELKFNNEKQQQDNYGMEDQHSTELSIAGNQESNFERYDYFLPSSDGNFIFLASD
STPIKIMRDEIDQVIKICPMSGNESKYIAFTKEKILLVNPENGELEKFEDIEDDYENYLN
HYIININQKLIKQLNIFTKRENWALTSTDVNLMIYEDFLYKGLQKNQLTENEDYIFMQDQ
HQDLKIKQKQSKIKIVDFQTDQEIIAIFSAVGFTNMFQKNVIVHNPLINTFISSEYDNTQ
IQIGGEKGIVSFNEGSNFQLIPLQISTKLKNQCLENKQCRERLIFSVDKFDDKNYIRDVM
TCIDNLRKGRMMIEVISDSKDIQNASNIPSQAFNFAKDNKITIFLLTFLIILVIILILKD
ERITSMYKRNSGRSGGKSSSQKQNSQEEADKVLEKISKEQEEEIKKQNEQNNKQEKKNQE
SSEQNANKFKGLQINRNKVLGYGAQGTVIFEGTFQGREIAVKQLLKDNKDLASKEIQMLI
KLQHKNIIKYYYFEETKDHILLGLEKCVGSISDLIDYANRKNKKKSEQDLKALYNIKTDF
FIKSTMKNTFKDCLEGLSYLHSQGVIHRDIKPENILIHYNKEIKLADFGLSKNISKTNVI
FTNDIGTWGWRPLEQIDNQPLTYNTDVFSLGCVFYYIYTQGGHPFGEQKERERNIANFKY
SLRMEDETLKDLIQKMIHNDQSKRLTVKECLKHPYFWNTLQKFSFICEFSDYIETFDTEN
KYSDLIEQQAKSLNVLEGNRWDKNVDKSLIQDTKVFKFYNYGQVKDLIRLIRNRKSHYHE
LSESSKDIVGDTLDDMFNYFDERFPKLFIFMYYFSQTQNWELLSFKNN