Identifiers and Description

Gene Model Identifier

TTHERM_00641220

Standard Name

MRNO44 (Membrane Occupation and Recognition Nexus protein other)

Aliases

PreTt10590 | 92.m00132

Description

phosphatidylinositol 4-phosphate 5-kinase

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_05192.1 9.997093137033517e-262
Description: hypothetical protein (329 aa)
Oxytricha Contig6341.0.g26 1.9996410647472548e-29
Description: MORN repeat
Stentor Coeruleus SteCoe_17503 2.3195228302435696e-16
Description: None
DictyBase DDB_G0349488 0.000000000000008002679274403579
Description: DDB_G0349488 on chromosome: 2 position 6912714 to 6914186
WormBase WBGene00002179 1
Description: locus:jph-1 status:Confirmed UniProt:Q22667 protein_id:CAA99924.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00641220(coding)
ATGATATAAAAAACTATAAAACTAAAAAATGGAGATATTTATGAAGGTAGTTATGATGAA
AAATAAATGAAAATGCATGGAAAAGGAACTTATAAATTTGCTAATGGGGATTTATATGAA
GGGGAATTTAAAGATAATAAATTTTGTGGCAGTGGAATAATTACTACAAAAGACTATATA
TTAAAAGGAGATTTTTTTGATAATAAGGCGAATGGTATGTGTATCATTGAATATAATTCA
GGAGATAAATATTAAGGAAGTGTTAAAAATAATTAAAAAAATGGAAGAGGAGTTCTATTA
TTCTCTAAAGACAATCCTAATTGTATCAGATATGATGGAGAATTTGATGCTGATTAGTAT
CATGGGGAAGGAAAATTGAATTTTAAAAAGCAAGAAATCATATATCAAGGTGCTTTTAGG
TTTGGGTAAATCCATGGTAAAGGCATAATTACTCACCCAAATTACACTTACGAAGGTAGT
TTTTAGTATGGTAAAAAAAATGGAAAAGGAATATTGAAATTTAAGAATTAGGAAGTGTAT
GAAGGAAGCTTTGAATCAGACTAGAAATAAGGATTTGGAATATATAGATATAAAGATGGA
GCATGCTATGAAGGAGAGTTTAAAAATGATGTTAAGCAAGGGAAAGGGAAGCTCACGATG
CCAAATGGAGAAATATATGAAGGTTACTTTTTGAATGGTAAGTTTGATGGTGATGGTAAA
TATACCTTCAAAGATGAAAATATAGTAATTGAAGGACAATTCAAAGAGAATATGGCTGAA
GGAAAATGCAGAATTTATCATTTTTCCAATAACTAACTCAATGATAAAACTCCAAATTAT
TACGAAGGGAGTTTTTATCATAATTCTAAGCATGGCCCCTGTAAGTTTGTCCTTCATAAA
AATAACGAAGTCTTAGGAGTATTTACAGGAAATTATGTACATAATATTGAAAAAGTAGTT
AATTCTGATTATGGAACAAGATTTTGA


>TTHERM_00641220(gene)
ATGATATAAAAAACTATAAAACTAAAAAATGGAGATATTTATGAAGGTAGTTATGATGAA
AAATAAATGAAAATGCATGGAAAAGGAACTTATAAATTTGCTAATGGGGATTTATATGAA
GGGGAATTTAAAGATAATAAATTTTGTGGCAGTGGAATAATTACTACAAAAGACTATATA
TTAAAAGGAGATTTTTTTGATAATAAGGCGAATGGTATGTGTATCATTGAATATAATTCA
GGAGATAAATATTAAGGAAGTGTTAAAAATAATTAAAAAAATGGAAGAGGAGTTCTATTA
TTCTCTAAAGACAATCCTAATTGTATCAGATATGATGGAGAATTTGATGCTGATTAGTAT
CATGGGGAAGGAAAATTGAATTTTAAAAAGCAAGAAATCATATATCAAGGTGCTTTTAGG
TTTGGGTAAATCCATGGTAAAGGCATAATTACTCACCCAAATTACACTTACGAAGGTAGT
TTTTAGTATGGTAAAAAAAATGGAAAAGGTAATAAATAAATAAATATTTAGCATACTTTT
ATTTTTTAAGTAGTGTTATATCAAAATAAGAATTCTATTTAATTATTAATTTTTTTAATT
AGATCAAAAGAAAATATGCTTTAAATATTTTAATGATTCTTGTTTGATAAATGAAAATAG
GAATATTGAAATTTAAGAATTAGGAAGTGTATGAAGGAAGCTTTGAATCAGACTAGAAAT
AAGGATTTGGAATATATAGATATAAAGATGGAGCATGCTATGAAGGAGAGTTTAAAAATG
ATGTTAAGCAAGGGAAAGGGAAGCTCACGATGCCAAATGGAGAAATATATGAAGGTTACT
TTTTGAATGGTAAGTTTGATGGTGATGGTAAATATACCTTCAAAGATGAAAATATAGTAA
TTGAAGGACAATTCAAAGAGAATATGGCTGAAGGAAAATGCAGAATTTATCATTTTTCCA
ATAACTAACTCAATGATAAAACTCCAAATTATTACGAAGGGAGTTTTTATCATAATTCTA
AGCATGGCCCCTGTAAGTTTGTCCTTCATAAAAATAACGAAGTCTTAGGAGTATTTACAG
GAAATTATGTACATAATATTGAAAAAGTAGTTAATTCTGATTATGGAACAAGATTTTGA


>TTHERM_00641220(protein)
MIQKTIKLKNGDIYEGSYDEKQMKMHGKGTYKFANGDLYEGEFKDNKFCGSGIITTKDYI
LKGDFFDNKANGMCIIEYNSGDKYQGSVKNNQKNGRGVLLFSKDNPNCIRYDGEFDADQY
HGEGKLNFKKQEIIYQGAFRFGQIHGKGIITHPNYTYEGSFQYGKKNGKGILKFKNQEVY
EGSFESDQKQGFGIYRYKDGACYEGEFKNDVKQGKGKLTMPNGEIYEGYFLNGKFDGDGK
YTFKDENIVIEGQFKENMAEGKCRIYHFSNNQLNDKTPNYYEGSFYHNSKHGPCKFVLHK
NNEVLGVFTGNYVHNIEKVVNSDYGTRF