Identifiers and Description

Gene Model Identifier

TTHERM_00647470

Standard Name

CTH7 (CaTHepsin 7)

Aliases

PreTt15853 | 93.m00149 | 3727.m00069

Description

CTH7 eukaryotic aspartyl protease

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF00026 ) Eukaryotic aspartyl protease
  • ( TIGR00013 ) 4-oxalocrotonate tautomerase family enzyme

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_08474.1 1.0003913505156363e-175
Description: eukaryotic aspartyl protease (335 aa)
DictyBase DDB_G0279411 1.999129405549486e-73
Description: ctsD on chromosome: 3 position 2104523 to 2105867
WormBase WBGene00000217 7.99612068409928e-70
Description: locus:asp-4 status:Confirmed UniProt:Q21966 protein_id:CAA90633.1
Oxytricha Contig19103.0.g52 3.9982663658145016e-63
Description: Eukaryotic aspartyl protease
SGD YPL154C 3.000235161122315e-61
Description: PEP4 Vacuolar aspartyl protease (proteinase A), required for the posttranslational precursor maturation of vacuolar proteinases; important for protein turnover after oxidative damage; synthesized as a zymogen, self-activates
Stentor Coeruleus SteCoe_31827 1.2160992992528256e-37
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00647470(coding)
ATGAATAAAAAGATTATTGCATTATTATTGTTGGTTGCAGTTTGTGCTGCCTAAACAATG
GAAAATGGTCCTATTGTCCGTGTTCCCATTATTAAGAGAGCTAGAACTGAAATTCAAAAA
AAGAATCTCCTTCTTAGACTTAAGGGTATTTATGACAACATTATTAACAAGATTTTCGGA
ATACGTGCTAATTCTTATTCTGAAGTTAAGGTCTAAAATTACGCTGACTTACAATATTTC
GGTTAAGTTTAAATTGGTACTCCTGCTTAAACATTCACTGTTGTCTTAGATACTGGTTCT
TCTGATTTATGGGTTCCCGGAACACCTTGCAACTCATTACCCTGTTTGGTCCACAACAAA
TTCAATCCTAAGAAATCTTCCACTTACGTTGACACTGGTAAGTCCTTCTCTATTCAATAC
GGTACTGGTGCTGTCAAGGGAACTGTTGCTAATGAAACTGTTTCTTTGGGAGGTTTGACT
GCTAAGAACGTCTAATTCGCTAACGCACATTAACTCTCTATGGATTTCTAAACCACTAAG
TTTGATGGTATTTTAGGTCTTGCTTACAATTAGCTTTCCAACATCGGCGGTTTAACTGTT
TTCGATTAATTGGTTGCTCAAGGTTTGGTTGCTTAAGACGTTTTCTCTTTCTACTTCAGT
GATAAGGAAAACAGCGATGATTCTGAATTGGTTTTGGGTGGTATCGATTTTGCTTATAAC
TCCACTGCTTTCAAGTACTATCCTGTCATTCTTTAAGCCTGGTACGTTATTGCTGCTGAC
TCCATTTAAATCGGAGGCGTAAACCTCAAGCTCAACACTGCTATTGTTGATAGTGGTACT
TCAGTTATTGTTGGTAACGCCGTTGTTTTGAATCCCATCATTAAGTTATTCCCTTCTAAA
ATTGACTGCTCTCAAATCAACACTTACCCCAATCTTACCATCACTATCTCTGGTGATAAC
TACGTTCTTGGACCCCAAGATTATATTGTTTAAATTAATTTACAAGGCTAATCTTAATGC
TTACTTGGTTTCTAAGCTCTTGAATTACCCGCTCAATTAGGTAACTCCATCATCTTAGGT
GATACTTTCTTCAGAAAGTACTACACTGTTTATGACAGAGTTAATAGCAGAGTCGGTTTC
GCTGTTGCTAATCACTCTAATAACAAGAGTTAATGA


>TTHERM_00647470(gene)
ATGAATAAAAAGATTATTGCATTATTATTGTTGGTTGCAGTTTGTGCTGCCTAAACAATG
GAAAATGGTCCTATTGTCCGTGTTCCCATTATTAAGAGAGCTAGAACTGAAATTCAAAAA
AAGAATCTCCTTCTTAGACTTAAGGGTATTTATGACAACATTATTAACAAGGTAATTTTC
TAAAAAATAATTTTCAATAAACAAATAAACATTAATTTGTTTAAATTCTTATTTAAATTA
AAAATTTTAATTTTTTATTTAAAATAGATTTTCGGAATACGTGCTAATTCTTATTCTGAA
GTTAAGGTCTAAAATTACGCTGACTTACAATATTTCGGTTAAGTTTAAATTGGTACTCCT
GCTTAAACATTCACTGTTGTCTTAGATACTGGTTCTTCTGATTTATGGGTTCCCGGAACA
GTAATTCTTTAATTTTGAATTTTTTACTATGAATATGAATTAAATGCATTTTAATTTACA
ATATATTGAAAAATTTTAATATAACTTTTTTTTATTATTTCAAAAAGCCTTGCAACTCAT
TACCCTGTTTGGTCCACAACAAATTCAATCCTAAGAAATCTTCCACTTACGTTGACACTG
GTAAGTCCTTCTCTATTCAATACGGTACTGGTGCTGTCAAGGGAACTGTTGCTAATGAAA
CTGTTTCTTTGGGAGGTTTGACTGCTAAGAACGTCTAATTCGCTAACGCACATTAACTCT
CTATGGATTTCTAAACCACTAAGTTTGATGGTATTTTAGGTCTTGCTTACAATTAGCTTT
CCAACATCGGCGGTTTAACTGTTTTCGATTAATTGGTTGCTCAAGGTTTGGTTGCTTAAG
ACGTTTTCTCTTTCTACTTCAGTGATAAGGAAAACAGCGATGATTCTGAATTGGTTTTGG
GTGGTATCGATTTTGCTTATAACTCCACTGCTTTCAAGTACTATCCTGTCATTCTTTAAG
CCTGGTACGTTATTGCTGCTGACTCCATTTAAATCGGAGGCGTAAACCTCAAGCTCAACA
CTGCTATTGTTGATAGTGGTACTTCAGTTATTGTTGGTAACGCCGTTGTTTTGAATCCCA
TCATTAAGTTATTCCCTTCTAAAATTGACTGCTCTCAAATCAACACTTACCCCAATCTTA
CCATCACTATCTCTGGTGATAACTACGTTCTTGGACCCCAAGATTATATTGTTTAAATTA
ATTTACAAGGCTAATCTTAATGCTTACTTGGTTTCTAAGCTCTTGAATTACCCGCTCAAT
TAGGTAACTCCATCATCTTAGGTGATACTTTCTTCAGAAAGTACTACACTGTTTATGACA
GAGTTAATAGCAGAGTCGGTTTCGCTGTTGCTAATCACTCTAATAACAAGAGTTAATGA


>TTHERM_00647470(protein)
MNKKIIALLLLVAVCAAQTMENGPIVRVPIIKRARTEIQKKNLLLRLKGIYDNIINKIFG
IRANSYSEVKVQNYADLQYFGQVQIGTPAQTFTVVLDTGSSDLWVPGTPCNSLPCLVHNK
FNPKKSSTYVDTGKSFSIQYGTGAVKGTVANETVSLGGLTAKNVQFANAHQLSMDFQTTK
FDGILGLAYNQLSNIGGLTVFDQLVAQGLVAQDVFSFYFSDKENSDDSELVLGGIDFAYN
STAFKYYPVILQAWYVIAADSIQIGGVNLKLNTAIVDSGTSVIVGNAVVLNPIIKLFPSK
IDCSQINTYPNLTITISGDNYVLGPQDYIVQINLQGQSQCLLGFQALELPAQLGNSIILG
DTFFRKYYTVYDRVNSRVGFAVANHSNNKSQ