Identifiers and Description

Gene Model Identifier

TTHERM_00648910

Standard Name

IFT52 (IntraFlagellar Transport 52 homolog)

Aliases

PreTt09205 | 94.m00123 | 3677.m00031

Description

IFT52 intraflagellar transporter-like protein; Intraflagellar transport protein; essential for ciliary assembly- maintenance- and rotokinesis

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF01857 ) Retinoblastoma-associated protein B domain

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_17844.1 9.997093137033517e-262
Description: IFT52/Intraflagellar transporter 52 (435 aa)
Oxytricha Contig15520.0.g51 2.0005106264580874e-134
Description: ABC-type uncharacterized transport system
WormBase WBGene00003886 2.9990539278805726e-74
Description: locus:osm-6 status:Confirmed UniProt:G5EDF6 protein_id:CAB61026.2
Stentor Coeruleus SteCoe_19883 3.1743585474772134e-60
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:12925756: Brown JM, Fine NA, Pandiyan G, Thazhath R, Gaertig J (2003) Hypoxia regulates assembly of cilia in suppressors of Tetrahymena lacking an intraflagellar transport subunit gene. Molecular biology of the cell 14(8):3192-207

Sequences

>TTHERM_00648910(coding)
ATGAGTGGAGAATAGAAAATTATTGTCTTCAACGCTTCAAAGAAGGAGGCTGGTAACCCT
AGTACAAATATTAAAAAGATTATCAAGAAATATAAAGAAACATATAAGTGCGGCAGAAAT
AAAGAAGATATCACATATGATAGACTAAAGATGGCTTCTTTGGTCATATTTTTTTGCCCC
AAAGAAATGTTTACCAAGGAGGAATTCGATGCCCTCAAATAATACTTAGAAAGTGGTGGT
CGTGTCTTAGTTTTGAGCTCTGAAGGTGGTGGTCATAAGAATCGCACAAATATAAATTTC
TTCTTGGAATAATATGGTATCAGTATCAATAACGATTGTGTCGTTAGAACTGCATTTTAT
AAATACTTCCATCCTAAGGAGACTTATGTTCATTCTGGTATTTTAAATGAAGAAGTAACA
AGAGTAGCAAATGGTTTACCTAAAGAAACAAAGAGACCCCAAAATACATTCTTGTAAAAC
GTTATTGGAAAGGATGATGAAGAAGATGAATATTAAAAGGAACAATCTAGAGTTGGTTTA
GATTTTGTTTATGCCTTTGGTGCTACCTTGACTGTTTAATAACCTGCACACGCTATTTTA
GGTTCTGGTCCTCTTTCTTACCCTTCTAATAGACCAGTTTCTGCTATCGTCTAAACTAAA
AATAATGGTAGACTTGCAGTTATTGGTTCATTCGAAATGTTTACAGATGAATATTTTGAC
AATGAAGATAACTCCAAGATTTTTGATTTCTTTATAAAATATTTGCTCACAAATGAGTGC
GAATTTGAATTTAGTCCTAAAGAACCTGATGTTGAATACTTCAAGGTTCCTGATATTGCT
GAATTAGCTGATAACCTCAAGAGTTGCTTACAAGAAAGTGACCCATTACCATTTGATAGC
AAGCAATTATTTATGACAGACTTGTTTAAGTATGATGTAGACTTAGTTCCAGAAGCTGTA
AAATTGTATGAAACTCTTGGAGTAAAGCACGATCCTCTTGCTCTTATAGTTCCTTAATTC
GAAACTCCACTCCTTGGACTTGTTTCAGCTGTTTTCCCACCTATTTTAAAAGAATTAGCT
CCTCCAAGTTTAGAATTGTTTGATTTAGATGATGAATTTGCTTCAGAAAAAGTAAGACTG
GCCTAACTCACAAATAAATGCAACAACAACGATTTAGATTATTACATTAAAGAATCAGGT
GATATCTTGGGTGTAACAGATAAAGTTAAGAACAAACATGATGCCAAAGCTATTTTAAGA
TATGTTTTAGAAGAATTAATAAATTTCAAGAAGCTCAATAACTGA


>TTHERM_00648910(gene)
ATGAGTGGAGAATAGAAAATTGTATTCAATTTTTCATAGTTTTAGCAGCTAGCTTTTATT
TTGATAGAATTCATGTCACTCAAATCGATCTATCATTTTAAAGATTTTTTTCCTAATATA
ATAAATAGATTGTCTTCAACGCTTCAAAGAAGGAGGCTGGTAACCCTAGTACAAATATTA
AAAAGATTATCAAGAAATATAAAGAAACATATAAGGTAATAGAGTTTATATTATTATCAT
TAATCAGTTTGACTTAGCAGATTTTGTCTTAAAGGGCTCTATTTCAAAAAATCAATCTAC
ATGCAAACCAATCTCTTACTTACGAAGGAGAAATATTTCAAAATATTTAACAAGAACAGT
TTTAAAAATAAATTGATTTTAACCAAAACAATTAAAAGAATTTATAATAAAATCTATATG
CGATTGATAATATAAGCCCTTAATAAGGTTTCTTATCTTAAGTTTGTTATTTTATCATAA
AGTGCGGCAGAAATAAAGAAGATATCACATATGATAGACTAAAGATGGCTTCTTTGGTCA
TATTTTTTTGCCCCAAAGAAATGTTTACCAAGGAGGAATTCGATGCCCTCAAATAATACT
TAGAAAGTGGTGGTCGTGTCTTAGTTTTGAGCTCTGAAGGTGGTGGTCATAAGTAATTAA
CATAAAAACAATTCTAAGAATGCCTTTCTATTTTTCTATATAATTTATTTTAAAATGCCT
CATTAAAATTTCAAAATTAATTCAAATCTTAGTTTAGAGATTAGCAAATATAAAAAGGCG
AGGATGAATGAATAAATGAAAATTTATAAATAGATTGATAAAACATGTTAATTTCAAAAA
TTAATTTATTAATGAAGCAAATAATAACTAAAGAAAGATGTTTAATTTTAAAATTTTATG
CAAACATACCAAAAAAACTCAGATAAAAACAAAATTTTAATAAAATAAGGAGAATATTTT
AAGCAACGCCTCGTACATTTATTTATCTTTAAGTTAATTCTAAAACTTATTATTTTATTT
AGAGAAAATAAATTCAAATTCTTAACTAAATTTAAACAAATTAAGATGAAAAAATGAATT
TTTTTGAAATGAAATTTGGATTGTATTAAAAAAATTGCATTCATTTTGCTAAAATATTTT
AATAAAAATTGAAATAAGCTTAGCAGATTCAAATAAATTTGGATAATGTCATAAAATAGT
TTGAATTTTACTAAATAATTTATCGAAATTCTTTGAAAACAATTTCATTATCAAGGAATC
TGAAAATTTATTTTTAAAAATATTTTAATATAAATTTAATAAAGCTTAACTGATTCAAAT
AGATTTGGAAAGTGTTATAAAAAAGTTTGAATTTCACTAAATAATTTGTCAAAGTTCTTT
GAGAACAATTTCATTATTTTTTTTCCAAGGAATCTGAAAATTAAAAAAAATATTTTAATA
TTGAAATAAGATTAACAGATTTTAATAAATTTGGAAAGTGTTATAAAAAAGTTTGAATTT
CACTAAATTATTTATCGAAATTATTTGATAACAATTTCATTATTTTTTTACAAATGAGGG
ATTTTAAAATAAGTTTGATATGTCTTAAAAAAATAATTTAAATTTTAAATAAAACTAATT
TGTAATTTATTAGAGTAAAAAAATATTTAATAAAATAGGAATCGCACAAATATAAATTTC
TTCTTGGAATAATATGGTATCAGTATCAATAACGATTGTGTCGTTAGAACTGCATTTTAT
AAATACTTCCATCCTAAGGAGACTTATGTTCATTCTGGTATTTTAAATGAAGAAGTAACA
AGAGTAGCAAATGGTTTACCTAAAGAAACAAAGAGACCCCAAAATACATTCTTGTAAAAC
GTTATTGGAAAGGATGATGAAGAAGATGAATATTAAAAGGAACAATCTAGAGTTGGTTTA
GATTTTGTTTATGCCTTTGGTGCTACCTTGACTGTTTAATAACCTGCACACGCTATTTTA
GGTTCTGGTCCTCTTTCTTACCCTTCTAATAGACCAGTTTCTGCTATCGTCTAAACTAAA
AATAATGGTAGACTTGCAGTTATTGGTTCATTCGAAATGTTTACAGATGAATATTTTGAC
AATGAAGATAACTCCAAGATTTTTGATTTCTTTATAAAATATTTGCTCACAAATGAGTGC
GAATTTGAATTTAGTCCTAAAGAACCTGATGTTGAATACTTCAAGGTTCCTGATATTGCT
GAATTAGCTGATAACCTCAAGAGTTGCTTACAAGTAAATTAATGAATATTATAACAGTTA
TTTAAATTTATGCATAATTAATTTTATATAGGAAAGTGACCCATTACCATTTGATAGCAA
GCAATTATTTATGACAGACTTGTTTAAGTATGATGTAGACTTAGTTCCAGAAGCTGTAAA
ATTGTATGAAACTCTTGGAGTAAAGCACGATCCTCTTGCTCTTATAGTTCCTTAATTCGA
AACTCCACTCCTTGGACTTGTTTCAGCTGTTTTCCCACCTATTTTAAAAGAATTAGCTCC
TCCAAGTTTAGAATTGTTTGATTTAGATGATGAATTTGCTTCAGAAAAGTAATTAATTTT
TATAAAAGAAGATTTTAAATATTTTCAAATAAATTCTAACAATATTTTTTTAAAAATTAA
CAGAGTAAGACTGGCCTAACTCACAAATAAATGCAACAACAACGATTTAGATTATTACAT
TAAAGAATCAGGTGATATCTTGGGTGTAACAGATAAAGTTAAGAACAAACATGATGCCAA
AGCTATTTTAAGATATGTTTTAGAAGAATTAGTAATTTAAAATTTTGATAAAAACAATAT
TTTAAGCATATTTTAATATTTAATAATAACAGATAAATTTCAAGAAGCTCAATAACTGA


>TTHERM_00648910(protein)
MSGEQKIIVFNASKKEAGNPSTNIKKIIKKYKETYKCGRNKEDITYDRLKMASLVIFFCP
KEMFTKEEFDALKQYLESGGRVLVLSSEGGGHKNRTNINFFLEQYGISINNDCVVRTAFY
KYFHPKETYVHSGILNEEVTRVANGLPKETKRPQNTFLQNVIGKDDEEDEYQKEQSRVGL
DFVYAFGATLTVQQPAHAILGSGPLSYPSNRPVSAIVQTKNNGRLAVIGSFEMFTDEYFD
NEDNSKIFDFFIKYLLTNECEFEFSPKEPDVEYFKVPDIAELADNLKSCLQESDPLPFDS
KQLFMTDLFKYDVDLVPEAVKLYETLGVKHDPLALIVPQFETPLLGLVSAVFPPILKELA
PPSLELFDLDDEFASEKVRLAQLTNKCNNNDLDYYIKESGDILGVTDKVKNKHDAKAILR
YVLEELINFKKLNN