Identifiers and Description

Gene Model Identifier

TTHERM_00649280

Standard Name

PRP9 (pre-mRNA processing factor 9)

Aliases

PreTt09242 | 94.m00160 | 3677.m00068

Description

PRP9 splicing factor 3a putative; splicesome-associated protein- putative

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_17885.1 9.997093137033517e-262
Description: splicesome-associated protein (525 aa)
Oxytricha Contig19116.0.1.g102 4.000944328304913e-112
Description: hypothetical protein
WormBase WBGene00011758 7.999011707514803e-86
Description: status:Confirmed UniProt:Q22469 protein_id:CAA91420.2
DictyBase DDB_G0270020 9.001321650308988e-69
Description: sf3a3 on chromosome: 1 position 4032294 to 4034133
Stentor Coeruleus SteCoe_268 5.665668176358939e-52
Description: None
SGD YDL030W 1.9993430003514377e-39
Description: PRP9 Subunit of the SF3a splicing factor complex, required for spliceosome assembly; acts after the formation of the U1 snRNP-pre-mRNA complex

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00649280(coding)
ATGTCAGCGAATTGGTTAGAGTAAACAAGAAGTGTTTTAGAAAACATTGAACTTCTTGAT
CAGACTGTTTTGGATTTCATGTTTGATAAACTTGAAAATCCTAAAGATTAGGTGATCATT
GATAATAAATTAAAAAATTTGATTGAAATGAAGTAAAGTAAATGCATGGATGCTTTAATA
TTACTATAAGATTTTGATGGCGTTAAGAAAGAAGAAATGGCTATCCTTGAAGGCAAAAAG
AGTGTTAGTGCTGGTACAAGATAGCCTGATATTTGGTATAATTTCTAATAGCGCTTAAAG
GATATTAAGGAATATTATAAAAAGCATTAGAATCAAAATATTTAAGTAATCGATAAGGAA
TTCTTGAAAAAAAATGTATTCAGTCCTCCTTATTCTGAACCTTTATTTTCTACTGATGAA
TAATAAGGAAAATATGTTGATATGAATGTGCTTTATTATGAATTTTTAAGTTTTGATTTA
AAGAAAAAGAAAAAAGTTAGACTTTCTGAAGATTACCACATTGGTGATTATTTGTGGTAC
TTAGAAAAGTTTGATGCCTTCCACGAAATTCCTCTTGCTCTTAAATAAAAAGAATATTCA
AGTTATAAGTAATACTTATAGAACCTTATTAATTACTTGAAGGAATTCTTTTTAAAAACT
CAACCTTTGACTGAGTTTTCCATTATTGATAGATAAATTCAGTAGGACTTCGAATATCGC
TGGAAAGAAGGATCTATTCCAGGCTGGACAAATTCAGGATATGAAGATGTTATTGATTAT
TCAAGCAATGAACTTTTCTGCAAAGCATGTAAGAAGTTATTCTCCAACAGTAGTATTTTC
GCCCATCACTTAGAAGGTAAGAAACATAAAATGGCTCAAAAAAATCTTGAAAAAGAAGAA
GAAAAAATGTCTAAATTAGAAGGAGCTCCTGAAAAAACTGATATGGGATAGGATGATTAA
GATTAGTAAACTACAGGAGAAATTAACATGAAGGATGAGTAAAAGAAAAAATAATTAGCT
CATTTAGAATAATATATTATAGGCTTGAAAAAATAATTAGGTGAGGTAATTAATGAAACT
ATCCTCTATGTTAAAAAGAAGCAAACAAGAACATATTAAGAAATTGAAGCAGAAAACCAA
TAAGAAAAGGATGCTGAACCCTAGAGTGATAGTGAAGATGATGACATTCCATACAATCCT
AAGAATGTGCCTTTGGGCCCTGATGGAAAGCCTATTCCATATTGGTTGTACAAGCTTCAC
TAGCTAGGTATTGAGTACAAATGTGAAATATGTGGTAACTACAGTTACTGGGGAAGAAGA
GCTTTTGAAAAGCATTTCTCAGAATGGAGACACAGTTATGGTATGAAGTGCTTAAAAATA
CCCAATACTATTCACTTCAAGGAAATTACATCTATCAAGGATGCTCTCGCTCTTCACCAT
AAACTTTCTATGGAAAGCGAATATTCTTAATTCAACATTGATCAAGAAGAAGAATATGAA
GATTCTGATGGAAATATACTTAACAAAAAGACTTATAATGATCTTAAAAAGCAAGGATTG
TTGTGA


>TTHERM_00649280(gene)
ATGTCAGCGAATTGGTTAGAGTAAACAAGAAGTGTTTTAGAAAACATTGAACTTCTTGAT
CAGACTGTTTTGGATTTCATGTTTGATAAACTTGAAAATCCTAAAGATTAGGTGATCATT
GATAATAAATTAAAAAATTTGATTGAAATGAAGTAAAGTAAATGCATGGATGCTTTAATA
TTACTATAAGATTTTGATGGCGTTAAGAAAGAAGAAATGGCTATCCTTGAAGGCAAAAAG
AGTGTTAGTGCTGGTACAAGATAGCCTGATATTTGGTATAATTTCTAATAGCGCTTAAAG
GATATTAAGGAATATTATAAAAAGCATTAGAATCAAAATATTTAAGTAATCGATAAGGAA
TTCTTGAAAAAAAATGTATTCAGTCCTCCTTATTCTGAACCTTTATTTTCTACTGATGAA
TAATAAGGAAAATATGTTGATATGAATGTGCTTTATTATGAATTTTTAAGTTTTGATTTA
AAGAAAAAGAAAAAAGTTAGACTTTCTGAAGATTACCACATTGGTGATTATTTGTGGTAC
TTAGAAAAGTTTGATGCCTTCCACGAAATTCCTCTTGCTCTTAAATAAAAAGAATATTCA
AGTTATAAGTAATACTTATAGAACCTTATTAATTACTTGAAGGAATTCTTTTTAAAAACT
CAACCTTTGACTGAGTTTTCCATTATTGATAGATAAATTCAGTAGGACTTCGAATATCGC
TGGAAAGAAGGATCTATTCCAGGCTGGACAAATTCAGGATATGAAGATGTTATTGATTAT
TCAAGCAATGAACTTTTCTGCAAAGCATGTAAGAAGTTATTCTCCAACAGTAGTATTTTC
GCCCATCACTTAGAAGGTAAGAAACATAAAATGGCTCAAAAAAATCTTGAAAAAGAAGAA
GAAAAAATGTCTAAATTAGAAGGAGCTCCTGAAAAAACTGATATGGGATAGGATGATTAA
GATTAGTAAACTACAGGAGAAATTAACATGAAGGATGAGTAAAAGAAAAAATAATTAGCT
CATTTAGAATAATATATTATAGGCTTGAAAAAATAATTAGGTGAGGTAATTAATGAAACT
ATCCTCTATGTTAAAAAGAAGCAAACAAGGTAAAGATCATTTATTTTAATTAAAAGATGT
ATTTTAAATTTATTTTTAAAAAAGAACATATTAAGAAATTGAAGCAGAAAACCAATAAGA
AAAGGATGCTGAACCCTAGAGTGATAGTGAAGATGATGACATTCCATACAATCCTAAGAA
TGTGCCTTTGGGCCCTGATGGAAAGCCTATTCCATATTGGTTGTACAAGCTTCACTAGCT
AGGTATTGAGTACAAATGTGAAATATGTGGTAACTACAGTTACTGGGGAAGAAGAGCTTT
TGAAAAGCATTTCTCAGAATGGAGACACAGTTATGGTATGAAGTGCTTAAAAATACCCAA
TACTATTCACTTCAAGGAAATTACATCTATCAAGGATGCTCTCGCTCTTCACCATAAACT
TTCTATGGAAAGCGAATATTCTTAATTCAACATTGATCAAGAAGAAGAATATGAAGATTC
TGATGGAAATATACTTAACAAAAAGACTTATAATGATCTTAAAAAGCAAGGATTGTTGTG
A


>TTHERM_00649280(protein)
MSANWLEQTRSVLENIELLDQTVLDFMFDKLENPKDQVIIDNKLKNLIEMKQSKCMDALI
LLQDFDGVKKEEMAILEGKKSVSAGTRQPDIWYNFQQRLKDIKEYYKKHQNQNIQVIDKE
FLKKNVFSPPYSEPLFSTDEQQGKYVDMNVLYYEFLSFDLKKKKKVRLSEDYHIGDYLWY
LEKFDAFHEIPLALKQKEYSSYKQYLQNLINYLKEFFLKTQPLTEFSIIDRQIQQDFEYR
WKEGSIPGWTNSGYEDVIDYSSNELFCKACKKLFSNSSIFAHHLEGKKHKMAQKNLEKEE
EKMSKLEGAPEKTDMGQDDQDQQTTGEINMKDEQKKKQLAHLEQYIIGLKKQLGEVINET
ILYVKKKQTRTYQEIEAENQQEKDAEPQSDSEDDDIPYNPKNVPLGPDGKPIPYWLYKLH
QLGIEYKCEICGNYSYWGRRAFEKHFSEWRHSYGMKCLKIPNTIHFKEITSIKDALALHH
KLSMESEYSQFNIDQEEEYEDSDGNILNKKTYNDLKKQGLL