Identifiers and Description

Gene Model Identifier

TTHERM_00655560

Standard Name

GND1 (6-phosphoGlucoNate Dehydrogenase 1)

Aliases

PreTt03654 | 96.m00123

Description

GND1 NAD-binding domain of 6-phosphogluconate dehydrogenase family protein; 6-phosphogluconate dehydrogenase (decarboxylating); catalyzes an NADPH-regenerating reaction in the pentose phosphate pathway

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF01488 ) Shikimate / quinate 5-dehydrogenase
  • ( PF02153 ) prephenate dehydrogenase
  • ( PF02737 ) 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
  • ( PF02826 ) erythronate-4-phosphate dehydrogenase
  • ( PF03446 ) NAD binding domain of 6-phosphogluconate
  • ( PF03807 ) NADP oxidoreductase coenzyme F420-dependent
  • ( PF07991 ) Acetohydroxy acid isomeroreductase, catalytic domain
  • ( TIGR00112 ) pyrroline-5-carboxylate reductase
  • ( TIGR00872 ) 6-phosphogluconate dehydrogenase (decarboxylating)
  • ( TIGR00873 ) 6-phosphogluconate dehydrogenase, decarboxylating
  • ( TIGR01505 ) 2-hydroxy-3-oxopropionate reductase
  • ( TIGR01692 ) 3-hydroxyisobutyrate dehydrogenase
  • ( TIGR03026 ) nucleotide sugar dehydrogenase

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_18003.1 9.997093137033517e-262
Description: NAD binding domain-6-phosphogluconate dehydrogenase (302 aa)
Oxytricha Contig10468.0.g95 6.000220702367707e-121
Description: NAD binding domain of 6-phosphogluconate dehydrogenase
Stentor Coeruleus SteCoe_386 2.572209372642415e-56
Description: None
DictyBase DDB_G0292566 4.00073564232477e-35
Description: hibA on chromosome: 6 position 1891263 to 1892228
WormBase WBGene00007122 1.999790113608142e-24
Description: Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial status:Confirmed UniProt:Q9XTI0 protein_id:CAB03798.1
SGD YGR256W 0.000000000006001570085597868
Description: GND2 6-phosphogluconate dehydrogenase (decarboxylating), catalyzes an NADPH regenerating reaction in the pentose phosphate pathway; required for growth on D-glucono-delta-lactone

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00655560(coding)
ATGGCTTAGTCTGCAATTAAAACTATCGGTTGGATTGGAACTGGTGTTATGGGTAAGTCT
ATGTGCTTACATTTGTTAAACGCTGGTTTCTAGCTAAATGTTTACAATAGAACTGCTAGT
AAGGCTGACGAATTAGTCAGTAAAGGAGCCAAGTTTTTAGCTCCTGAAGATTTAGCTAAA
AATTCTGATGTAGTATTTTTGATGCTTGGTTATCCTCATGATGTCTAATAAATGGTATTA
GGTGAATAAGGAATTTTAAAGCACATGAAAAAAGGTTCCTTATTGATTGACCACACTACA
TCCGCTCCTTCTCTTGCTGTAGAAATTGCAGCCGAAGCATAAAAGTATGGAATCGAAAGT
ATTGATGCCCCAGTTAGTGGAGGTGATATCGGAGCTAGAGAAGCTAGATTAGCAATTATG
TGTGGCGGTTCCCAAGCTGCTTTTGATCTTGCTCTTCCTATTTTATAAAAGTATGGTGCA
AATATCTAATTATTAGGTGGCGCAGGAGCAGGATAACACACCAAAATGACTAATTAAATT
TTATTAGCTAGCAATATGTTAGGTGTTGTTGAAGGCTTACTCTATGCTCATAAGGCTGGA
TTAGATTTAGATTAAGTAATTAATCTTATTAAGACTGGTGCTGCCTCATCTACTGCATGG
CACGTTCTTGGCTCAAGAATGGTTAAGCGTGACTTTGAACCTGGCTTCTATGTAGAGCAT
TTTATTAAGGATATGGATATTGCCTTAGAAGAGGCCAAAAGAGCTAACTTATGTCTCCCT
GGATTAGGCTTAGTAAAGTAATTTTATCATGCCTTAGTTGCATAAGGAGGTGCTCGTAAT
GGAACTTAAGCTATCATTAAAGTTTTAGAATAAATGAACAATGTTTAAATCGGAAAGAAA
TAATGA


>TTHERM_00655560(gene)
ATGGCTTAGTCTGCAATTAAAACTATCGGTTGGATTGGAACTGGTGTTATGGGTAAGTCT
ATGTGCTTACATTTGTTAAACGCTGGTTTCTAGCTAAATGTTTACAATAGAACTGCTAGT
AAGGCTGACGAATTAGTCAGTAAAGGAGCCAAGTTTTTAGCTCCTGAAGATTTAGCTAAA
AATTCTGATGTAGTATTTTTGATGCTTGGTTATCCTCATGATGTCTAATAAATGGTATTA
GGTGAATAAGGAATTTTAAAGCACATGAAAAAAGGTTCCTTATTGATTGACCACACTACA
TCCGCTCCTTCTCTTGCTGTAGAAATTGCAGCCGAAGCATAAAAGTATGGAATCGAAAGT
ATTGATGCCCCAGTTAGTGGAGGTGATATCGGAGCTAGAGAAGCTAGATTAGCAATTATG
TGTGGCGGTTCCCAAGCTGCTTTTGATCTTGCTCTTCCTATTTTATAAAAGTATGGTGCA
AATATCTAATTATTAGGTGGCGCAGGAGCAGGATAACACACCAAAATGACTAATTAAATT
TTATTAGCTAGCAATATGTTAGGTGTTGTTGAAGGCTTACTCTATGCTCATAAGGCTGGA
TTAGATTTAGATTAAGTAATTAATCTTATTAAGACTGGTGCTGCCTCATCTACTGCATGG
CACGTTCTTGGCTCAAGAATGGTTAAGCGTGACTTTGAAGTAAATTCTTTAATAATAAAC
ATTCTAAAATTCTATTAAAATACAAAAAAAATAAGATATATTTTAACAAAGCTATAATTT
ATAAAATATCTTTTTTGATGATAAAAATTTTGTTTTTTAAATCTTTGTTTTTCTTAGTTT
AATTATTTTTATTAAATAATAGCCTGGCTTCTATGTAGAGCATTTTATTAAGGATATGGA
TATTGCCTTAGAAGAGGCCAAAAGAGCTAACTTATGTCTCCCTGGATTAGGCTTAGTAAA
GTAATTTTATCATGCCTTAGTTGCATAAGGAGGTGCTCGTAATGGAACTTAAGCTATCAT
TAAAGTTTTAGAATAAATGAACAATGTTTAAATCGGAAAGAAATAATGA


>TTHERM_00655560(protein)
MAQSAIKTIGWIGTGVMGKSMCLHLLNAGFQLNVYNRTASKADELVSKGAKFLAPEDLAK
NSDVVFLMLGYPHDVQQMVLGEQGILKHMKKGSLLIDHTTSAPSLAVEIAAEAQKYGIES
IDAPVSGGDIGAREARLAIMCGGSQAAFDLALPILQKYGANIQLLGGAGAGQHTKMTNQI
LLASNMLGVVEGLLYAHKAGLDLDQVINLIKTGAASSTAWHVLGSRMVKRDFEPGFYVEH
FIKDMDIALEEAKRANLCLPGLGLVKQFYHALVAQGGARNGTQAIIKVLEQMNNVQIGKK
Q