Identifiers and Description

Gene Model Identifier

TTHERM_00658760

Standard Name

TAP19 (Telomerase- (or TERT-) associated protein of 19 kDa)

Aliases

PreTt02161 | 97.m00147 | 3724.m00054

Description

TAP19 predicted protein; Telomerase holoenzyme subunit p19; essential gene; knockdown induces telomere shortening

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_16216.1 2.9993408039826107e-81
Description: hypothetical protein (196 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00658760(coding)
ATGGAAGAAATATATTGTTAAAATATTTTACAAAAGATAAGATTTTGTTTGGGAATCATT
AAAATTGAAAAAAAAGAAATGCAGTAGCCTAAGAGAAACTTTGATTTGTATAAACTCATT
ACAGACAAGTAGATAGATTTTTAAGTAGCTGATTTGATTCAAGATGAGTAGTCTTCATTT
GTTTCTGTACGCATTTATGGTCAATTTAAATGCTTTGTACCAAAAAGTACTATTTAAGAG
TAATTAGATAAAATAAAAAATTTATCTAGTAAAGAATTAGCTAAAAACAAAATATTTAAA
TTTCTCTCTGAGTACAATAAAAATAATTAAAAATAAGATGAACTATCTCATGATTACTAT
GGATACTTTAAGGTTTAGTAGCACCAATTTATACTCAATTTAGAAAATGCTCAAAGAGAA
GCAAGCTTGGCAGTAGATGATTTCTACTTTATTAATGGGAGAATTTATAAAACTAATCAC
GATATTTTGATTCTGCAAGCTCATCATGTATATTAAATGCAAAAACCTACTCTTTAATTG
CTTCAAGCTGCGTCAGAAATTAATCAAAATTGA


>TTHERM_00658760(gene)
ATGAAGCCTAATTTAAGGATTTATATGTAAATTTTTTTATATTATTATTTAATCAATAAT
TTTTGATGTTGATTTTTATAATTTTTATGTGTATTTAAGAAAAAGATATTTTGCTTATTT
AGAATAAATATTTTAAAATGCATTAATTACACTTCATTTGAATTTAATTTAAAATTTTTT
TTCATTTTAAGTATTTAGTTAGAAATAAATCATTCAAAATGGAAGAAATATATTGTTAAA
ATATTTTACAAAAGATAAGATTTTGTTTGGGAATCATTAAAATTGAAAAAAAGTTAAAAA
TCCGCAAAATTTGATAATTTAGAAAAATTAAAATTGCTTTAAACAATTTAAAATAAGTGA
TTGTATTTGTTTTTATTATTAGAGAAATGCAGTAGCCTAAGAGAAACTTTGATTTGTATA
AACTCATTACAGACAAGTAGATAGATTTTTAAGTAGCTGATTTGATTCAAGATGAGTAGT
CTTCATTTGTTTCTGTACGCATTTATGGTCAATTTAAATGCTTTGTACCAAAAAGTACTA
TTTAAGAGTAATTAGATAAAATAAAAAATTTATCTAGTAAAGAATTAGCTAAAAACAAAA
TATTTAAATTTCTCTCTGAGTACAATAAAAATAATTAAAAATAAGATGAACTATCTCATG
ATTACTATGGATACTTTAAGGTTTAGTAGCACCAATTTATACTCAATTTAGAAAATGCTC
AAAGAGAAGCAAGCTTGGCAGTAGATGATTTCTACTTTATTAATGGGAGAATTTATAAAA
CTAATCACGATATTTTGATTCTGCAAGCTCATCATGTATATTAAATGCAAAAACCTACTC
TTTAATTGCTTCAAGCTGCGTCAGAAATTAATCAAAATTGA


>TTHERM_00658760(protein)
MEEIYCQNILQKIRFCLGIIKIEKKEMQQPKRNFDLYKLITDKQIDFQVADLIQDEQSSF
VSVRIYGQFKCFVPKSTIQEQLDKIKNLSSKELAKNKIFKFLSEYNKNNQKQDELSHDYY
GYFKVQQHQFILNLENAQREASLAVDDFYFINGRIYKTNHDILILQAHHVYQMQKPTLQL
LQAASEINQN