Identifiers and Description
Gene Model Identifier
TTHERM_00660180Standard Name
HMGB1 (High MoBility group 1)Aliases
PreTt23762 | 98.m00105 | 3736.m00006 | HMGBDescription
HMGB high mobility group (HMG) box protein; High-Mobility-Group (HMG) protein; induces negative supercoiling of DNA in vitro; present in both macro- and micronuclei but with elevated expression during both macronuclear S phase and endoreplication of developing new macronucleiGenome Browser (Macronucleus)
Genome Browser (Micronucleus)
External Links
Gene Ontology Annotations
Cellular Component
- macronucleus (IDA) | GO:0031039
- micronucleus (IDA) | GO:0031040
- nucleus (IEA) | GO:0005634
Molecular Function
- DNA binding (IDA) | GO:0003677
- DNA binding (IEA) | GO:0003677
- DNA topoisomerase activity (IDA) | GO:0003916
Biological Process
- conjugation with mutual genetic exchange (IEP) | GO:0000748
Domains
- ( PF00505 ) HMG (high mobility group) box
Gene Expression Profile
Vegetative Cell Cycle (Zhang et al., 2023)
GeneMania
Tetrahymena Stock Center
Homologs
Source Identifier Score Tetrahymena borealis EI9_17254.1 5.001636743996964e-56 Description: HMG box family protein (147 aa) SGD YDR174W 0.000006997203421143941 Description: HMO1 Chromatin associated high mobility group (HMG) family member involved in genome maintenance; rDNA-binding component of the Pol I transcription system; associates with a 5-3 DNA helicase and Fpr1p, a prolyl isomerase WormBase WBGene00022182 0.0000899730839127287 Description: locus:swsn-3 status:Confirmed UniProt:Q9BL39 protein_id:CCD73870.1 WormBase WBGene00021867 0.0000899730839127287 Description: status:Confirmed UniProt:Q95XK5 protein_id:CCD73846.1 Oxytricha Contig12963.0.1.g3 0.00010003404299092957 Description: HMG (high mobility group) box Stentor Coeruleus SteCoe_14619 0.0024787521766663585 Description: None
General Information
No Data fetched for General Information
Associated Literature
- Ref:31932604: Nabeel-Shah S, Ashraf K, Saettone A, Garg J, Derynck J, Lambert JP, Pearlman RE, Fillingham J (2020) Nucleus-specific linker histones Hho1 and Mlh1 form distinct protein interactions during growth, starvation and development in Tetrahymena thermophila. Scientific reports 10(1):168
- Ref:8264578: Wu M, Allis CD, Sweet MT, Cook RG, Thatcher TH, Gorovsky MA (1994) Four distinct and unusual linker proteins in a mitotically dividing nucleus are derived from a 71-kilodalton polyprotein, lack p34cdc2 sites, and contain protein kinase A sites. Molecular and cellular biology 14(1):10-20
- Ref:8417323: Wang T, Allis CD (1993) An abundant high-mobility-group-like protein is targeted to micronuclei in a cell cycle-dependent and developmentally regulated fashion in Tetrahymena thermophila. Molecular and cellular biology 13(1):163-73
- Ref:1589033: Lilley DM (1992) DNA--protein interactions. HMG has DNA wrapped up. Nature 357(6376):282-3
- Ref:1480473: Wang T, Allis CD (1992) Replication-dependent and independent regulation of HMG expression during the cell cycle and conjugation in Tetrahymena. Nucleic acids research 20(24):6525-33
- Ref:1991550: Schulman IG, Wang TT, Stargell LA, Gorovsky MA, Allis CD (1991) Cell-cell interactions trigger the rapid induction of a specific high mobility group-like protein during early stages of conjugation in Tetrahymena. Developmental biology 143(2):248-57
- Ref:1986218: Schulman IG, Wang T, Wu M, Bowen J, Cook RG, Gorovsky MA, Allis CD (1991) Macronuclei and micronuclei in Tetrahymena thermophila contain high-mobility-group-like chromosomal proteins containing a highly conserved eleven-amino-acid putative DNA-binding sequence. Molecular and cellular biology 11(1):166-74
- Ref:2514183: Suda M, Hayashi H (1989) A protein that accumulates during starvation in Tetrahymena nuclei. Journal of biochemistry 106(4):612-5
- Ref:2760016: Hayashi T, Hayashi H, Iwai K (1989) Tetrahymena HMG nonhistone chromosomal protein. Isolation and amino acid sequence lacking the N- and C-terminal domains of vertebrate HMG 1. Journal of biochemistry 105(4):577-81
- Ref:2476991: Hamana K, Kawada K (1989) Release of nucleosomes from nuclei by bleomycin-induced DNA strand scission. Biochemistry international 18(5):971-9
- Ref:3584238: Schulman IG, Cook RG, Richman R, Allis CD (1987) Tetrahymena contain two distinct and unusual high mobility group (HMG)-like proteins. The Journal of cell biology 104(6):1485-94
- Ref:3109974: Prasanna P, Holmlund CE (1987) Identification in Tetrahymena pyriformis of 3-hydroxy-3-methyl glutaryl coenzyme a lyase: its purification and properties. The International journal of biochemistry 19(4):385-9
- Ref:3671074: Roth SY, Schulman IG, Cook RG, Allis CD (1987) The complete amino acid sequence of an HMG-like protein isolated from the macronucleus of Tetrahymena. Nucleic acids research 15(19):8112
- Ref:6849878: Levy-Wilson B, Denker MS, Ito E (1983) Isolation, characterization, and postsynthetic modifications of tetrahymena high mobility group proteins. Biochemistry 22(7):1715-21
- Ref:6258140: Hamana K, Zama M (1980) Selective release of HMG nonhistone proteins during DNase digestion of Tetrahymena chromatin at different stages of the cell cycle. Nucleic acids research 8(22):5275-88
- Ref:117005: Hamana K, Iwai K (1979) High mobility group nonhistone chromosomal proteins also exist in Tetrahymena. Journal of biochemistry 86(3):789-94
Sequences
>TTHERM_00660180(coding)
ATGTCTAAAGCTGCTAGCCAATACGCAACTCTCGAAGATCTCCCCTCCAAGCCCAAGAGA
CCCCAAACCGGTTTCTTCATCTACAAGAGTGAAGTCTTTGCCAAGAGAAGAACTGAGTGC
CCCAACTTGAAGGTCCCTGAAATCGTCTCTAAAATTAGTGAAGAATACAAGGCCTTACCT
GAAAAGGAGAAGTAAAAATACGAAGAAGCCTACAGAAAGGAAAAGGCCACCTACGATAAG
TAAAACGACCAATGGAAAGAGAAGTATGGTGATATCGAAAAGTCCTTGAAGGATTAGGCT
AAGAAGGCCCTCAAGGAAAAGACCAAAAAGTCCAAGGCTGCTGAAAAGGAACTTGAAAAG
AGCAAGAAGAAGGCTCCCGCTGCTGCCCCTGCCAAGAAGGACGATAAGAAGGCTCCCGCT
AAGAAGAAATGA>TTHERM_00660180(gene)
ATGTCTAAAGCTGCTAGCCAATACGCAACTCTCGAAGATCTCCCCTCCAAGCCCAAGAGA
CCCCAAACCGGTTTCTTCATCTACAAGAGTGAAGTCTTTGCCAAGAGAAGAACTGAGTGC
CCCAACTTGAAGGTCCCTGAAATCGTCTCTAAAATTAGTGAAGAATACAAGGCCTTACCT
GAAAAGGAGAAGTAAAAATACGAAGAAGCCTACAGAAAGGAAAAGGCCACCTACGATAAG
TAAAACGACCAATGGAAAGAGAAGTATGGTGATATCGAAAAGTCCTTGAAGGATTAGGCT
AAGAAGGCCCTCAAGGAAAAGACCAAAAAGTCCAAGGCTGCTGAAAAGGAACTTGAAAAG
AGCAAGAAGAAGGCTCCCGCTGCTGCCCCTGCCAAGAAGGACGATAAGAAGGCTCCCGCT
AAGAAGAAATGA>TTHERM_00660180(protein)
MSKAASQYATLEDLPSKPKRPQTGFFIYKSEVFAKRRTECPNLKVPEIVSKISEEYKALP
EKEKQKYEEAYRKEKATYDKQNDQWKEKYGDIEKSLKDQAKKALKEKTKKSKAAEKELEK
SKKKAPAAAPAKKDDKKAPAKKK