Identifiers and Description

Gene Model Identifier

TTHERM_00660410

Standard Name

CTH122 (CaTHepsin 122)

Aliases

PreTt23785 | 98.m00128 | 3736.m00029

Description

CTH122 papain family cysteine protease

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF00112 ) Papain family cysteine protease
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_09209.1 9.001411022034644e-122
Description: papain family cysteine protease containing protein (324 aa)
Oxytricha Contig322.1.g116 3.998862432046419e-53
Description: Papain family cysteine protease
DictyBase DDB_G0290957 9.997441244797434e-45
Description: cprA on chromosome: 5 position 4812963 to 4814596
WormBase WBGene00000776 7.00174216458014e-43
Description: locus:cpl-1 status:Confirmed UniProt:O45734 protein_id:CAB07275.1
Stentor Coeruleus SteCoe_27084 1.7587922024243116e-25
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00660410(coding)
ATGAATTCTAAGTTTATCCTTTTGAGTATTGCTTTGCTTATGCCTCTTTACTTAGCTTAA
AATGTTTTTATTGAAAAACTCATAGCTTACAATAAGTGGTCCAGTAAAAATTTAAGAACC
TTTTTGAACAATGAAGAAAAGCTATTTAGACAATTAGTTTTCTTTGAAAACTTACAAAAG
GTCAATTATCACAATGCCCAAGACCACCACACTTACTCACTTGCTTTAAACTAATTTTCT
GATATGACAGAAGAGGAATTTGCTGAGAAAATTCTTATGTAATCTGATCTAGTTGATCTT
CACATTCAATAAACTGCCAGTCATAACTCGACTTCTTCTACTACTGGAGGATCTACTTCA
TCTAATTCTACAAGTAATAATGCAACAGTTACTGTAGACTGGAGATCTAAAGGTGCTGTG
ACTCCAGTTAAATAATAAGGCTATTGTAGCTCTTGCTGGGCATTCTCTGCAGCTGGTTTA
ATGGAATCTTTTAATTTCATTAAGAATAAAAATTTAACAGATTTTTCTGAATAGTAACTT
GTTGATTGTGTGAACTCTGCAAATGGCTACTCTTCTAAAGGATGTAGTGGAGGATGGCCT
GCATCAGCTATAGATTATTCCTCAAAGTTCGGTATCACAACCTTACAAAACTATCCATAT
ATTGGTGTTTAAAAGAAGTGTAATATTACTGGAACTAACAATGGTTTTAAACCTAAATCT
TGGAAGCAAATTCCTAATACTTCTAAAGATTTATAAAATGCTTTAAATTATTCACCAGTT
TCTATTGCTGTTGATGCTTCTACTTGGAGTCACTATAAATCTGGAGTCTACAACGGCTGC
AACTAAACCGACATTAAGATTAATCATGGTGTGTTAGCTATTGGTTACGATTCTCTTGGT
AACTGGATTGTTAAAAACTCTTGGGGTACTGGTTGGGGTGAGCAAGGTTACATTAGACTT
GCTCCTAATAATACTTGTGGTATTTTAAGCTATAATTACTAAATTACAGCTTGA


>TTHERM_00660410(gene)
ATGAATTCTAAGTTTATCCTTTTGAGTATTGCTTTGCTTATGCCTCTTTACTTAGCTTAA
AATGTTTTTATTGAAAAACTCATAGCTTACAATAAGTGGTCCAGTAAAAATTTAAGAACC
TTTTTGAACAATGAAGAAAAGCTATTTAGACAATTAGTTTTCTTTGAAAACTTACAAAAG
GTCAATTATCACAATGCCCAAGACCACCACACTTACTCACTTGCTTTAAACTAATTTTCT
GATATGACAGAAGAGGAATTTGCTGAGAAAATTCTTATGTAATCTGATCTAGTTGATCTT
CACATTCAATAAACTGCCAGTCATAACTCGACTTCTTCTACTACTGGAGGATCTACTTCA
TCTAATTCTACAAGTAATAATGCAACAGTTACTGTAGACTGGAGATCTAAAGGTGCTGTG
ACTCCAGTTAAATAATAAGGCTATTGTAGCTCTTGCTGGGCATTCTCTGCAGCTGGTTTA
ATGGAATCTTTTAATTTCATTAAGAATAAAAATTTAACAGATTTTTCTGAATAGTAACTT
GTTGATTGTGTGAACTCTGCAAATGGCTACTCTTCTAAAGGATGTAGTGGAGGATGGCCT
GCATCAGCTATAGATTATTCCTCAAAGTTCGGTATCACAACCTTACAAAACTATCCATAT
ATTGGTGTTTAAAAGAAGTGTAATATTACTGGAACTAACAATGGTTTTAAACCTAAATCT
TGGAAGCAAATTCCTAATACTTCTAAAGATTTATAAAATGCTTTAAATTATTCACCAGTT
TCTATTGCTGTTGATGCTTCTACTTGGAGTCACTATAAATCTGGAGTCTACAACGGCTGC
AACTAAACCGACATTAAGATTAATCATGGTGTGTTAGCTATTGGTTACGATTCTCTTGGT
AACTGGATTGTTAAAAACTCTTGGGGTACTGGTTGGGGTGAGCAAGGTTACATTAGACTT
GCTCCTAATAATACTTGTGGTATTTTAAGCTATAATTACTAAATTACAGCTTGA


>TTHERM_00660410(protein)
MNSKFILLSIALLMPLYLAQNVFIEKLIAYNKWSSKNLRTFLNNEEKLFRQLVFFENLQK
VNYHNAQDHHTYSLALNQFSDMTEEEFAEKILMQSDLVDLHIQQTASHNSTSSTTGGSTS
SNSTSNNATVTVDWRSKGAVTPVKQQGYCSSCWAFSAAGLMESFNFIKNKNLTDFSEQQL
VDCVNSANGYSSKGCSGGWPASAIDYSSKFGITTLQNYPYIGVQKKCNITGTNNGFKPKS
WKQIPNTSKDLQNALNYSPVSIAVDASTWSHYKSGVYNGCNQTDIKINHGVLAIGYDSLG
NWIVKNSWGTGWGEQGYIRLAPNNTCGILSYNYQITA