Identifiers and Description

Gene Model Identifier

TTHERM_00660420

Standard Name

CTH108 (CaTHepsin 108)

Aliases

PreTt23786 | 98.m00129 | 3736.m00030

Description

CTH108 papain family cysteine protease

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF00112 ) Papain family cysteine protease
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_09209.1 1.0001366335892501e-125
Description: papain family cysteine protease containing protein (324 aa)
Oxytricha Contig322.1.g116 2.0008958828286524e-54
Description: Papain family cysteine protease
DictyBase DDB_G0272815 3.0009061039838537e-46
Description: cprE on chromosome: 2 position 2212329 to 2213613
WormBase WBGene00000776 7.999101194912153e-45
Description: locus:cpl-1 status:Confirmed UniProt:O45734 protein_id:CAB07275.1
Stentor Coeruleus SteCoe_29303 4.780892883885469e-25
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00660420(coding)
ATGAATTCTAAGTATATTCTTTTGAGTATTGCTTTATTTATGAATCTTTACTTAGCTTAA
AATGTTTCTATTGAAAAACTCCTAGCTTACAATAAGTGGTCAAGTTAAAATTTAAGAACC
TTCTTGAACGATGAAGAAAAGCTATTTAGACAATTAGTCTTCTTTGAAAACTTACAAAAG
GTCTAAGATCACAATAGCCAAGACAACCACACTTACTTCCTTGAGTTAAACTAATTTTCT
GATATGACTCAATAGGAGTTTGTAGAGAAAGTTCTAATGAAATCTGATTTGGTCGATCTT
CACATTTAATAAACTACCAGTAATAACTCAACTTCTTCTGCTACTGAAGTATCTAATTCT
ACAAGTAATAATGCAGCAGATAATGTAGACTGGAGAACTAAAGGTGCTGTAACTTCAGTT
AAAAACTAAGGTTAATGTGGCTCTTGCTGGGCATTCTCTGCTGCTGGTTTAATGGAATCT
TTTAATTTCATTAAGAATAAAAATTTAGTCAATTTTTCTGAATAGTAACTTGTCGATTGC
ATGAACTTTGAAAATGGTTACTCTTCTAATGGATGTAATGGAGGATGGCCTGAATCATGC
TTAGATTATTCTTCAAAGTTCGGTATCACCACATTATAAAACTATCCATATGTGGGTGTT
TAAAAGAAGTGTAACATTACTGGAACTAACAATGGTTTTAAACCTTAATCTTGGAAGAAA
ATTCCTAATACTTCTAAGGATTTATAAATTGCTTTAAATAGCTCACCAGTTTCTGTTCTT
GTTGATGCTTCTACTTGGAGTCACTATAAATCTGGTGTCTACAATGGATGCGACTAAACC
AAAATTTGGCTTAATCATGCTGTATTAGCTGTTGGTTACGATTCTGTTGGTAACTGGATT
GTTAAAAACTCTTGGGGAACTAGTTGGGGTGAGGAAGGTTATATTAGAATTTCTCCTAAT
AATACTTGTGGTATTCTAAAGTTTAATTATCAAATTACAGCTTGA


>TTHERM_00660420(gene)
ATGAATTCTAAGTATATTCTTTTGAGTATTGCTTTATTTATGAATCTTTACTTAGCTTAA
AATGTTTCTATTGAAAAACTCCTAGCTTACAATAAGTGGTCAAGTTAAAATTTAAGAACC
TTCTTGAACGATGAAGAAAAGCTATTTAGACAATTAGTCTTCTTTGAAAACTTACAAAAG
GTCTAAGATCACAATAGCCAAGACAACCACACTTACTTCCTTGAGTTAAACTAATTTTCT
GATATGACTCAATAGGAGTTTGTAGAGAAAGTTCTAATGAAATCTGATTTGGTCGATCTT
CACATTTAATAAACTACCAGTAATAACTCAACTTCTTCTGCTACTGAAGTATCTAATTCT
ACAAGTAATAATGCAGCAGATAATGTAGACTGGAGAACTAAAGGTGCTGTAACTTCAGTT
AAAAACTAAGGTTAATGTGGCTCTTGCTGGGCATTCTCTGCTGCTGGTTTAATGGAATCT
TTTAATTTCATTAAGAATAAAAATTTAGTCAATTTTTCTGAATAGTAACTTGTCGATTGC
ATGAACTTTGAAAATGGTTACTCTTCTAATGGATGTAATGGAGGATGGCCTGAATCATGC
TTAGATTATTCTTCAAAGTTCGGTATCACCACATTATAAAACTATCCATATGTGGGTGTT
TAAAAGAAGTGTAACATTACTGGAACTAACAATGGTTTTAAACCTTAATCTTGGAAGAAA
ATTCCTAATACTTCTAAGGATTTATAAATTGCTTTAAATAGCTCACCAGTTTCTGTTCTT
GTTGATGCTTCTACTTGGAGTCACTATAAATCTGGTGTCTACAATGGATGCGACTAAACC
AAAATTTGGCTTAATCATGCTGTATTAGCTGTTGGTTACGATTCTGTTGGTAACTGGATT
GTTAAAAACTCTTGGGGAACTAGTTGGGGTGAGGAAGGTTATATTAGAATTTCTCCTAAT
AATACTTGTGGTATTCTAAAGTTTAATTATCAAATTACAGCTTGA


>TTHERM_00660420(protein)
MNSKYILLSIALFMNLYLAQNVSIEKLLAYNKWSSQNLRTFLNDEEKLFRQLVFFENLQK
VQDHNSQDNHTYFLELNQFSDMTQQEFVEKVLMKSDLVDLHIQQTTSNNSTSSATEVSNS
TSNNAADNVDWRTKGAVTSVKNQGQCGSCWAFSAAGLMESFNFIKNKNLVNFSEQQLVDC
MNFENGYSSNGCNGGWPESCLDYSSKFGITTLQNYPYVGVQKKCNITGTNNGFKPQSWKK
IPNTSKDLQIALNSSPVSVLVDASTWSHYKSGVYNGCDQTKIWLNHAVLAVGYDSVGNWI
VKNSWGTSWGEEGYIRISPNNTCGILKFNYQITA