Identifiers and Description

Gene Model Identifier

TTHERM_00661660

Standard Name

GST38 (Glutathione S-transferase mu 38, TtGSTm38, GSTm38)

Aliases

PreTt23811 | 98.m00154 | 3736.m00054

Description

GST38 glutathione S-transferase amine-terminal domain protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00043 ) Glutathione S-transferase, C-terminal domain
  • ( PF02798 ) Glutathione S-transferase, N-terminal domain

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_17213.1 2.998573346093879e-125
Description: glutathione S-transferase domain-containing protein (220 aa)
Oxytricha Contig16299.0.g15 1.9994920269952867e-34
Description: Glutathione S-transferase, N-terminal domain
Stentor Coeruleus SteCoe_31482 1.5628821893349888e-18
Description: None
WormBase WBGene00001760 0.00000000030007160092483236
Description: locus:gst-12 status:Confirmed UniProt:Q93695 protein_id:CAB02288.1
DictyBase DDB_G0274081 0.00000005001214305021125
Description: DDB_G0274081 on chromosome: 2 position 3748941 to 3749724

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00661660(coding)
ATGGCTACTTTAGGATATTGGGGTTTTAGAGGTTTAGCATAACCTATTCGTTTTTTATTA
GCTTATTTGGGTGTACAATATACTGATAAACACTACACAAAAGGAGAAGATTGGTTTGAA
AATGATAAAAAGAATTTAGGAATGGACTTTCCTAATATTCCTTATTTCATTGATAACGAT
ATTAAAATTAGCGAATCATCTGCAATCCCTTTCTATATAATCAAGAAGTATAAAAAACCC
GAACTATTAGGCTAGAATGCCGACGGATCTTTCAACGAAAAGGAAATTAAAGTTCAATAA
GTGATCGGCGTTATTAAAGATATCAATAAAGAATTGATGGGACTTTGCTTCAATCCTGAC
TTTGCTAATGCCAAAGACAAGGTTTACAACGAAAAACTTTCAGTAGGTCTTAAAAAATTA
AATGACTTCTTAGGCAACAAAGATTTCTTGCTTGGTACTCTAACATATGCAGATTTCTTA
TTCTATGAGACACTTTCTTACTTCAAACACATTTTCCCTTAAAGTATTACTCCTACCCTT
GCAAATTACTTAAATAGATTCCAAAATCTTCCTGGAGTCAAGGAATATATTGCTAAACCT
TCAGTAGATCTTAATGCCTTTTTACCTCCCTAAAGAGCTGCTTGGCATGGTCCTAAATGA


>TTHERM_00661660(gene)
ATGGCTACTTTAGGATATTGGGGTTTTAGAGGTTTAGCATAACCTATTCGTTTTTTATTA
GCTTATTTGGGTGTACAATATACTGATAAACACTACACAAAAGGAGAAGATTGGTTTGAA
AATGATAAAAAGAATTTAGGAATGGACTTTCCTAATATTCCTTATTTCATTGATAACGAT
ATTAAAATTAGCGAATCATCTGCAATCCCTTTCTATATAATCAAGAAGTATAAAAAACCC
GAACTATTAGGCTAGAATGCCGACGGATCTTTCAACGAAAAGGAAATTAAAGTTCAATAA
GTGATCGGCGTTATTAAAGATATCAATAAAGAATTGATGGGACTTTGCTTCAATCCTGAC
TTTGCTAATGCCAAAGACAAGGTTTACAACGAAAAACTTTCAGTAGGTCTTAAAGTAAAT
ATTCATGTTTATCTCAATTAAAAAACTATGTTTAAAATATTATATTTTTTAAATTCTTAA
AAATAAATGCAAGCATGTTTGTAAAATAAATATATAAAAATATTTTAATTCTGTTTAATA
GAAATTAAATGACTTCTTAGGCAACAAAGATTTCTTGCTTGGTACTCTAACATATGCAGA
TTTCTTATTCTATGAGACACTTTCTTACTTCAAACACATTTTCCCTTAAAGTATTACTCC
TACCCTTGCAAATTACTTAAATAGATTCCAAAATCTTCCTGGAGTCAAGGAATATATTGC
TAAACCTTCAGTAGATCTTAATGCCTTTTTACCTCCCTAAAGAGCTGCTTGGCATGGTCC
TAAATGA


>TTHERM_00661660(protein)
MATLGYWGFRGLAQPIRFLLAYLGVQYTDKHYTKGEDWFENDKKNLGMDFPNIPYFIDND
IKISESSAIPFYIIKKYKKPELLGQNADGSFNEKEIKVQQVIGVIKDINKELMGLCFNPD
FANAKDKVYNEKLSVGLKKLNDFLGNKDFLLGTLTYADFLFYETLSYFKHIFPQSITPTL
ANYLNRFQNLPGVKEYIAKPSVDLNAFLPPQRAAWHGPK