Identifiers and Description

Gene Model Identifier

TTHERM_00664030

Standard Name

DESI1 (DeSumoylating Isopeptidase 1)

Aliases

PreTt23850 | 98.m00193 | 3736.m00091 | LC3A

Description

DESI1 thioredoxin domain protein; SUMO-specific protease; deSUMOylase; removes Smt3p from protein substrates; Desi1p is distinct from the Sentrin-specific proteases (SENP) family of deSUMOylases

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00085 ) Thioredoxin
  • ( PF05903 ) Eukaryotic protein of unknown function
  • ( TIGR00385 ) periplasmic protein thiol:disulfide oxidoreductases, DsbE
  • ( TIGR01068 ) thioredoxin
  • ( TIGR01126 ) protein disulfide-isomerase domain
  • ( TIGR02196 ) Glutaredoxin-like protein, YruB-family

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_17191.1 9.997093137033517e-262
Description: thioredoxin family protein (325 aa)
DictyBase DDB_G0292886 7.998505003885351e-50
Description: DDB_G0292886 on chromosome: 6 position 2214235 to 2215853
Oxytricha Contig17686.0.g39 1.999534248571833e-46
Description: PPPDE putative peptidase domain
Stentor Coeruleus SteCoe_20593 7.095474162284704e-23
Description: None
WormBase WBGene00021933 1.999598840915195e-17
Description: status:Partially_confirmed UniProt:Q9N357 protein_id:CCD67239.1
SGD YCR083W 0.000000000000004001928599951003
Description: TRX3 Mitochondrial thioredoxin, highly conserved oxidoreductase required to maintain the redox homeostasis of the cell, forms the mitochondrial thioredoxin system with Trr2p, redox state is maintained by both Trr2p and Glr1p

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00664030(coding)
ATGGCTGAACAAAAGCATAGGGTAGTAGTTAATTTGTATGATTTATCTGGAGGTATGGCT
AGAGTTTTCTCTCCCATGTTCCTTTAGAAACAAATTGATGGAATTTGGCACACTGGTTGT
GTTGTTTACGGTAAGGAATTTTATTTTGGTGGAGGCATCTGCTCTGGCTTACCAAAATAG
ACACCTTACGGAACACCAGTTTAGTAAATAGATGTTGGAGAGACTGAAGTTCCTGAAGAA
GTCTTTACAGAGTTTTTGAGAGATATTTCAGATAGATTTACTATGGATAAATATGACTTA
TTTAAAAATAATTGCAACAACTTTACTGATGAATGTACTCATTTCCTAACAGGATAACAT
ATTCCTGAGTATATAACAGGTTTACCTGATGAAGTATTAAATACTCCTATGGGTCAAATG
ATAAAACCTCTTGTTGATCAAATGCAATAATCCGTTGTAAATGCAAGTGGTTAATCAGCA
CTATTCCCAGCTTAGTTTGAAGGTGTTAATAATCCTCAATAAATGTTTGGAAATAATTAA
CAATAATAATAATAATAGCAATAGGCACCTATTTTCCCTAATGGTATAAATAATACAGAT
ATCCTCAATAAATTTACTTAGTTGAATAATAACTAACCAGTTGATATGAAGAAAGTTGAA
GAAGCAACTGATTTAATGGATTACTTTACTAAGGTAGAGGGACAAAAAGCAGTGATTATC
GACTTTAACGCTGATTGGTGTGGACCTTGTTAAGTAATCAAGCCAATATTTGCTTAATAT
AGTGAAGAATACCCAAATATCAAATTTATTTCTGTAAATACAGAAAAAAACAAGGAGGTT
GCCCAATAATTTGGCATTTAATCTCTCCCCACCTTCATCACCCTTCATGAAGGTGAAATA
TCTGCAACTTGGAAAGGAGCTAATCAAGTAAACTTAAAAAATAACCTTGATAAATTAGCA
GAAAAGCTTAAATGA


>TTHERM_00664030(gene)
ATGGCTGAACAAAAGCATAGGGTAGTAGTTAATTTGTATGATTTATCTGGAGGTATGGCT
AGAGTTTTCTCTCCCATGTTCCTTTAGAAACAAATTGATGGAATTTGGCACACTGGTTGT
GTTGTTTACGGTAAGGAATTTTATTTTGGTGGAGGCATCTGCTCTGGCTTACCAAAATAG
ACACCTTACGGAACACCAGTTTAGTAAATAGATGTTGGAGAGACTGAAGTTCCTGAAGAA
GTCTTTACAGAGTTTTTGAGAGATATTTCAGATAGATTTACTATGGATAAATATGACTTA
TTTAAAAATAATTGCAACAACTTTACTGATGAATGTACTCATTTCCTAACAGGATAACAT
ATTCCTGAGTATATAACAGGTTTACCTGATGAAGTATTAAATACTCCTATGGGTCAAATG
ATAAAACCTCTTGTTGATCAAATGCAATAATCCGTTGTAAATGCAAGTGGTTAATCAGCA
CTATTCCCAGCTTAGTTTGAAGGTGTTAATAATCCTCAATAAATGTTTGGAAATAATTAA
CAATAATAATAATAATAGCAATAGGCACCTATTTTCCCTAATGGTATAAATAATACAGAT
ATCCTCAATAAATTTACTTAGTTGAATAATAACTAACCAGTTGATATGAAGAAAGTTGAA
GAAGCAACTGATTTAATGGATTACTTTACTAAGGTAGAGGGACAAAAAGCAGTGATTATC
GACTTTAACGCTGATTGGTGTGGACCTTGTTAAGTAATCAAGCCAATATTTGCTTAATAT
AGTGAAGAATACCCAAATATCAAATTTATTTCTGTAAATACAGAAAAAAACAAGGAGGTT
GCCCAATAATTTGGCATTTAATCTCTCCCCACCTTCATCACCCTTCATGAAGGTGAAATA
TCTGCAACTTGGAAAGGAGCTAATCAAGTAAACTTAAAAAATAACCTTGATAAATTAGCA
GAAAAGCTTAAATGA


>TTHERM_00664030(protein)
MAEQKHRVVVNLYDLSGGMARVFSPMFLQKQIDGIWHTGCVVYGKEFYFGGGICSGLPKQ
TPYGTPVQQIDVGETEVPEEVFTEFLRDISDRFTMDKYDLFKNNCNNFTDECTHFLTGQH
IPEYITGLPDEVLNTPMGQMIKPLVDQMQQSVVNASGQSALFPAQFEGVNNPQQMFGNNQ
QQQQQQQQAPIFPNGINNTDILNKFTQLNNNQPVDMKKVEEATDLMDYFTKVEGQKAVII
DFNADWCGPCQVIKPIFAQYSEEYPNIKFISVNTEKNKEVAQQFGIQSLPTFITLHEGEI
SATWKGANQVNLKNNLDKLAEKLK