Identifiers and Description

Gene Model Identifier

TTHERM_00666960

Standard Name

FDD4 (Fatty acid Desaturase Domain)

Aliases

PreTt23948 | 99.m00189

Description

FDD4 fatty acid desaturase

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_16588.1 9.997093137033517e-262
Description: fatty acid desaturase (385 aa)
Oxytricha Contig9505.0.g59 2.0005131442217614e-40
Description: Fatty acid desaturase
Stentor Coeruleus SteCoe_11266 0.000000000000012664165549094176
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00666960(coding)
ATGGATATATTTTTAGATTCTTTGCAGTTTTACACCCCTGTTTTTAACAACATACTTCTA
TTTATAGGGGCAGAGTACTTTAATAATGGATATTTTTTAGGCTTTTTTTTGCAGTGCTTA
GCAAAAAAGGTCGATTAGATTTTACCCTTGGATGACAAGAATATGAATAAAGAAGAATCA
AATAGAAAGAAAAACCATTTTTTATACACAATCCCTCTATTTTTAGCTGTTATTTCTGAT
ACATTGTAAATGTTTTATGTGATAAATAAAGTTACTAGCAGTGGCTCTTAACTTTCTGCC
TTGAACTGCTTCCTTTTGATAAGCTCTGCAGGTTTAACTTTGGGTAATACTGTTAATGTT
TCGCATGAGTTAATTCATAGATTAACAACTTTAGAGTAGGCAGTAGGATTTTTGAATTTT
GTAAGAGTTATGTACTGCCATTATCCTATATTCCATTTGCTATGGCACCATAAGCATGTT
GGAACTGACAAAGATCCTATTGTAGCAAAAAAAGATGAAACTTTGTATTAGTATCTTCCT
AGATAGCTTTGGGGTAACTACGCTGTTTCATGGAAGTGTGAAAATGAAAGATTGATTTAA
CAAGAAAAGACTTCATTCCCTTAATTTCATTACAAAAATAGAATGATTTATAATACTCTG
CTTTAACTTGCCTTCCCTTTACTAATGCTGGTTACATATGGAAGAAAAGGATTATATTAC
TATTTATGGATGGTTTTTGTAGCAGTTATTGAAGCTGAAATTGTTGAATACTTGGAACAT
TATGGTCTTTTTGTCACAAAAGATAATAAAGTTTCTTACGATTGTGCTTGGAACTCTCCT
TAAAGGTATACAAACATATCTTCATTTAAGCTTGAAAGACATGCTGATCATCATGTAAAT
GCCTATAAAGAATATTAAATTTCAAGCTTCGATTATTCATGGCCTTAGCTGCCTGAGAGC
TACTTATTTATGATTTAGGTTTCAATGTAACCAAAGCTCTGGTTTTCTATCATGAATCCT
CGTTTAGAGTCCTTTTTTGCTAAAAAAGAAGTGTCTAAGGAGCATTAAGAATTCGAAAAA
AAGACTCTTGATAATTTCTATAAATAGCAAATCTTGACTCACTCAATAATTTTATTAATC
TCATTCTTATTTTGA


>TTHERM_00666960(gene)
ATGGATATATTTTTAGATTCTTTGCAGTTTTACACCCCTGTTTTTAACAACATACTTCTA
TTTATAGGGGCAGAGTACTTTAATAATGGATATTTTTTAGGCTTTTTTTTGCAGTGCTTA
GCAAAAAAGGTCGATTAGATTTTACCCTTGGATGACAAGAATATGAATAAAGAAGAATCA
AATAGAAAGAAAAACCATTTTTTATACACAATCCCTCTATTTTTAGCTGTTATTTCTGAT
ACATTGTAAATGTTTTATGTGATAAATAAAGTTACTAGCAGTGGCTCTTAACTTTCTGCC
TTGAACTGCTTCCTTTTGATAAGCTCTGCAGGTTTAACTTTGGGTAATACTGTTAATGTT
TCGCATGAGTTAATTCATAGATTAACAACTTTAGAGTAGGCAGTAGGTAAGTTAATCATT
ATTTTTTATAGATCCAATGCTATTTTTATTATTTTAAATAGGATTTTTGAATTTTGTAAG
AGTTATGTACTGCCATTATCCTATATTCCATTTGCTATGGCACCATAAGCATGTTGGAAC
TGACAAAGATCCTATTGTAGCAAAAAAAGATGAAACTTTGTATTAGTATCTTCCTAGATA
GCTTTGGGGTAACTACGCTGTTTCATGGAAGTGTGAAAATGAAAGATTGATTTAACAAGA
AAAGACTTCATTCCCTTAATTTCATTACAAAAATAGAATGATTTATAATACTCTGCTTTA
ACTTGCCTTCCCTTTACTAATGCTGGTTACATATGGAAGAAAAGGATTATATTACTATTT
ATGGATGGTTTTTGTAGCAGTTATTGAAGCTGAAATTGTTGAATACTTGGAACATTATGG
TCTTTTTGTCACAAAAGATAATAAAGTTTCTTACGATTGTGCTTGGAACTCTCCTTAAAG
GTATACAAACATATCTTCATTTAAGCTTGAAAGACATGCTGATCATCATGTAAATGCCTA
TAAAGAATATTAAATTTCAAGCTTCGATTATTCATGGCCTTAGCTGCCTGAGAGCTACTT
ATTTATGATTTAGGTTTCAATGTAACCAAAGCTCTGGTTTTCTATCATGAATCCTCGTTT
AGAGTCCTTTTTTGCTAAAAAAGAAGTGTCTAAGGAGCATTAAGAATTCGAAAAAAAGAC
TCTTGATAATTTCTATAAATAGCAAATCTTGACTCACTCAATAATTTTATTAATCTCATT
CTTATTTTGA


>TTHERM_00666960(protein)
MDIFLDSLQFYTPVFNNILLFIGAEYFNNGYFLGFFLQCLAKKVDQILPLDDKNMNKEES
NRKKNHFLYTIPLFLAVISDTLQMFYVINKVTSSGSQLSALNCFLLISSAGLTLGNTVNV
SHELIHRLTTLEQAVGFLNFVRVMYCHYPIFHLLWHHKHVGTDKDPIVAKKDETLYQYLP
RQLWGNYAVSWKCENERLIQQEKTSFPQFHYKNRMIYNTLLQLAFPLLMLVTYGRKGLYY
YLWMVFVAVIEAEIVEYLEHYGLFVTKDNKVSYDCAWNSPQRYTNISSFKLERHADHHVN
AYKEYQISSFDYSWPQLPESYLFMIQVSMQPKLWFSIMNPRLESFFAKKEVSKEHQEFEK
KTLDNFYKQQILTHSIILLISFLF