Identifiers and Description

Gene Model Identifier

TTHERM_00670360

Standard Name

MRNC06 (Membrane Occupation and Recognition Nexus protein C-terminal)

Aliases

PreTt01060 | 100.m00121 | 3731.m00031

Description

MORN motif protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_16450.1 9.997093137033517e-262
Description: hypothetical protein (362 aa)
Oxytricha Contig3507.0.0.g29 2.0004286606204839e-16
Description: MORN repeat
DictyBase DDB_G0290679 0.000004000864880866421
Description: DDB_G0290679 on chromosome: 5 position 4358106 to 4360111
WormBase WBGene00002179 0.00003998524687536623
Description: locus:jph-1 status:Confirmed UniProt:Q22667 protein_id:CAA99924.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00670360(coding)
ATGGAAAGCGATAACTGTGCTTATCACCCAGCAAAATAAATAGAATTAATATGTTTAGAA
GAGAGTTGCCCTGAAAAAGGATGTATGTTTTGTGCATTTTGTTTCTTAGTTGATGGAGTT
CATCACAATCATAAATTTGTAGAAAGTGAAAAAATTCAATAATTTGTAGAAGAAAATGGG
GAAAGATTTTTACAGAAAGTAATTCAAAAAGCTGACTAAATGTGTTATGAGCTGACTACA
GAAATATGGAACTTTAAAAATTTTTTTGTGGACTATGCTAAAAAGTGTATTTAAGAGCTA
ACAGACCTTTTATAAAGCTCTGACTAAGAGCATCTAATAAATAATATCAGCCTAATATAA
GATATTTAAACAATTGTAGAAGAAAATGAAAACCATCGCATATTTTAAATGATAAAATCA
TCTTAATAGCGAATAACGTTGCACTTAAAAAATTGCATAATACCTTTAGATTATAGTTAT
GAGAAGGTTTATTAATTTGAAAAAAATAAGATAAAAGACTTGATAGATAAATATACTTAA
TTTTAATTGACTGATTCTGTAAAGACTACATTATAGTAAATAGAACCTTTTTTATATGAC
CAGCCTCATTTGGAGAACTTTAAGTATCCTTAATTAGTTGAAGAGTAATATAAAAAAACT
AAGGACATATCTTTCAAGTAATATGATTTAGAAACAAAACGCTCTAATGGAAGAGGTATG
ATTATTAGAGAAGATGGGAGTTATTTTGAGGGATATTTTTTAGATGGTAAAATAGAGGGA
AAAGGTAGAAATATATGGCCAGAAGGAGATTGGTATGAAGGTGGATTTAAAAAAGGTAAA
AAACATGGATTTGGGACACAGAGGTTGAGTGATAAACTTTATTTTGGAGAATATGTAGAA
GATTATAGAGAGGGTTATGGGACAATTATATTTGATAATGGAGATACTTATAGAGGATGT
ATGTATTAAGATAATATGTGTGGCTATGGAGAACTTATTACTGCAAATGGAAAGATGGTT
AGAGGGTATTTTGTTGACAACGAATTTAAAGGATAGACTTATAATGATGTAATTAAATAA
GATTTTTAAAATCTAAAAATCTAATGA


>TTHERM_00670360(gene)
ATGGAAAGCGATAACTGTGCTTATCACCCAGCAAAATAAATAGAATTAATATGTTTAGAA
GAGAGTTGCCCTGAAAAAGGATGTATGTTTTGTGCATTTTGTTTCTTAGTTGATGGAGTT
CATCACAATCATAAATTTGTAGAAAGTGAAAAAATTCAATAATTTGTAGAAGAAAATGGG
GAAAGATTTTTACAGAAAGTAATTCAAAAAGCTGACTAAATGTGTTATGAGCTGACTACA
GAAATATGGAACTTTAAAAATTTTTTTGTGGACTATGCTAAAAAGTGTATTTAAGAGCTA
ACAGACCTTTTATAAAGCTCTGACTAAGAGCATCTAATAAATAATATCAGCCTAATATAA
GATATTTAAACAATTGTAGAAGAAAATGAAAACCATCGCATATTTTAAATGATAAAATCA
TCTTAATAGCGAATAACGTTGCACTTAAAAAATTGCATAATACCTTTAGATTATAGTTAT
GAGAAGGTTTATTAATTTGAAAAAAATAAGATAAAAGACTTGATAGATAAATATACTTAA
TTTTAATTGACTGATTCTGTAAAGACTACATTATAGTAAATAGGTAAATAATAAATTATT
TAATATAAAATGAAAATTAAATATAAAGATTGATATATATAAATGTATTTAGAACCTTTT
TTATATGACCAGCCTCATTTGGAGAACTTTAAGTATCCTTAATTAGTTGAAGAGTAATAT
AAAAAAACTAAGGACATATCTTTCAAGTAATATGATTTAGAAACAAAACGCTCTAATGGA
AGAGGTATGATTATTAGAGAAGATGGGAGTTATTTTGAGGGGTATATTTTTATTTTCTTT
GGAGTGTTAAAAAATTTATCATTTTTGTTGTAAATAAATAGATATTTTTTAGATGGTAAA
ATAGAGGGAAAAGGTAGAAATATATGGCCAGAAGGAGATTGGTATGAAGGTGGATTTAAA
AAAGGTAAAAAACATGGATTTGGGACACAGAGGTTGAGTGATAAACTTTATTTTGGAGAA
TATGTAGAAGATTATAGAGAGGGTTATGGGACAATTATATTTGATAATGGAGATACTTAT
AGAGGATGTATGTATTAAGATAATATGTGTGGCTATGGAGAACTTATTACTGCAAATGGA
AAGATGGTTAGAGGGTATTTTGTTGACAACGAATTTAAAGGATAGACTTATAATGATGTA
ATTAAATAAGATTTTTAAAATCTAAAAATCTAATGA


>TTHERM_00670360(protein)
MESDNCAYHPAKQIELICLEESCPEKGCMFCAFCFLVDGVHHNHKFVESEKIQQFVEENG
ERFLQKVIQKADQMCYELTTEIWNFKNFFVDYAKKCIQELTDLLQSSDQEHLINNISLIQ
DIQTIVEENENHRIFQMIKSSQQRITLHLKNCIIPLDYSYEKVYQFEKNKIKDLIDKYTQ
FQLTDSVKTTLQQIEPFLYDQPHLENFKYPQLVEEQYKKTKDISFKQYDLETKRSNGRGM
IIREDGSYFEGYFLDGKIEGKGRNIWPEGDWYEGGFKKGKKHGFGTQRLSDKLYFGEYVE
DYREGYGTIIFDNGDTYRGCMYQDNMCGYGELITANGKMVRGYFVDNEFKGQTYNDVIKQ
DFQNLKIQ