Identifiers and Description

Gene Model Identifier

TTHERM_00670500

Standard Name

CCT6 (Chaperonin Containing TCP-1 ortholog 6)

Aliases

PreTt01074 | 100.m00135 | 3731.m00045

Description

CCT6 TCP-1 (CTT or eukaryotic type II) chaperonin family zeta subunit

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

  • nucleobase-containing small molecule catabolic process (IEA) | GO:0034656

Domains

  • ( PF00118 ) TCP-1/cpn60 chaperonin family
  • ( TIGR02339 ) thermosome, various subunits, archaeal
  • ( TIGR02340 ) T-complex protein 1, alpha subunit
  • ( TIGR02341 ) T-complex protein 1, beta subunit
  • ( TIGR02342 ) T-complex protein 1, delta subunit
  • ( TIGR02343 ) T-complex protein 1, epsilon subunit
  • ( TIGR02344 ) T-complex protein 1, gamma subunit
  • ( TIGR02345 ) T-complex protein 1, eta subunit
  • ( TIGR02346 ) T-complex protein 1, theta subunit
  • ( TIGR02347 ) T-complex protein 1, zeta subunit
  • ( TIGR02348 ) chaperonin GroL

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Stentor Coeruleus SteCoe_16600 0
Description: None
WormBase WBGene00000381 9.997093137033517e-262
Description: locus:cct-6 T-complex protein 1 subunit zeta status:Confirmed UniProt:P46550 protein_id:CCD65990.1
Tetrahymena borealis EI9_16462.1 9.997093137033517e-262
Description: TCP-1/cpn60 chaperonin family protein (536 aa)
DictyBase DDB_G0277493 9.997093137033517e-262
Description: cct6 on chromosome: 2 position 8001157 to 8003005
Oxytricha Contig1206.0.g42 9.997093137033517e-262
Description: TCP-1/cpn60 chaperonin family
SGD YDR188W 9.997093137033517e-262
Description: CCT6 Subunit of the cytosolic chaperonin Cct ring complex, related to Tcp1p, essential protein that is required for the assembly of actin and tubulins in vivo; contains an ATP-binding motif

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00670500(coding)
ATGTCTAACGTTCAATATGTCAATTCTAAGGCTGAAGTCTTAAAGAAGTTCTAGGCTCTT
GCCATGAATATCCATGCCGCTGTCGGCTTACAAGAAGTCATGAGATCTAACCTTGGTCCT
AAGGGTACTCTCAAGATGCTTGTTGGTGGTGCTGGTTAAATCAAGCTTACCAAGGACGGT
TCAGTCTTATTACATGAAATGTAAATTCAACACCCCACTGCTGCCATGATTGCTCGTTCT
GCCACTGCTCAAGATGATATTGTCGGTGATGGTACCACCTCTAACGTCCTCTTCATTGGT
GAAATGATGAAATAAGCTCAAAGATTAATTCAAGATGGTATCCACCCCAGAACTATTACT
GATGGTTACGAAGCTGCCAAGCACGAATCTCTTAAGTTCTTAGACGAATTCAAGTAAAAC
CTCACTGAATCATAAATCGACAAGGCTTTCCTTCTTTCTGTCGCTAGAACTTCTTTGAAC
ACTAAGCTCCACCCTGATATTGCTAACTAATTGGTTGAAATAGTCGTTGACTCCGTTCTT
TGCATCAAGCAATAAGATAAACCTATTGATTTACATATGGTTGAAATTATGCACATGGTT
CACAAGCTCTCTACTGATACTAGATTAGTTAAGGGTTTAGTTTTAGATCATGGTGCTCGT
CATGCTGATATGCCCAAGAAACTTAAGAACTGTTACATTCTTAATTGCAACGTTTCTTTA
GAATACGAAAAGACTGAAGTCCACTCTGGTTTCTTCTATTCCAACGCTGCTGACAGAGAA
AAGTTGATGCTTTCTGAACGTAAATTCACTGATGAAAGATGCCAAAAGATTATTGACCTC
AAGAGAAAGGTTTGCGAAGACCCCTCTAAGTCCTTTGTTGTTCTCAACTAAAAGGGTATT
GACCCCATTTGCCTTGATATGTTTGCTAAGGAAAATATCATCGCTTTGAGAAGAACAAAG
AGAAGAAACATGGAAAGAATCATTCTTGCTTGTGGTGGTAACGGTGTTAACTCCGTTGAA
GATTTATCTGAAGCTGATCTTGGTTGGGCTGATGAAGTTTATGAACACACTTTGGGTGAA
GAAAAGTACACTTTCATTGAAGGTGTCAAGAATCCCAAGTCATGCACCATTCTTATCAAG
GGACCTAACGAGCACACTATTGCTCAAATTAAGGAAGCTATCAGAGATGGTTTAAGAGCT
GTTAAAAACGTTTTTGATGACAAGTGCGTTATCCCTGGTGCTGGTGCTTTTGAAATTGGT
GCTTACTGCCATTTACAAAAGTTCAAGGATTCCGTTAAGGGTAAGGCTAAATTAGGTGTT
GAAGCCTTTGCTGAATCTTTACTCATCATCCCCAAGATTTTAGCTGAAAACTGCGGTTAT
GATGTTTAAGATACAATCCTTGAAGTTATCGATGAATATAAAGCCAAGTAAGTTCCTGTT
GGTATCAACTGCAACGAAAAGGGTACTATTTCTCCTGTTGCTTCTGCTATTTATGATAAC
TATATTGCCAAGAAGCAATTCTTACATATGGCTCCTACTCTTGCCCAATAACTCCTTCTT
GTTGACGAAATCATGAGAGCTGGTAAATAGATGGGTGGTGGTAATTGA


>TTHERM_00670500(gene)
ATGTCTAACGTTCAATATGTCAATTCTAAGGCTGAAGTCTTAAAGAAGTTCTAGGCTCTT
GCCATGAATATCCATGCCGCTGTCGGCTTACAAGAAGTCATGAGATCTAACCTTGGTCCT
AAGGGTACTCTCAAGATGTAATTTATTTTGAATTTAACTCATAATCTCTACTAAATAACA
TATAGATCATCTCATTTTGAGCCCTATTTAAAATCATTTTTCCGCCTTAATATTTAGCAA
AGGAATTAACTTTTTACTTAAGTTTTTTGAGAAACATTAAGTGGTTGATATAAAAATATT
AAGACTTTTATTAACTTTGATAGAGCTACACTTTTATTATTTTAAACTATGAATTATTCT
AATCGCAATTTTAATAATATTTAGGCTTGTTGGTGGTGCTGGTTAAATCAAGCTTACCAA
GGACGGTTCAGTCTTATTACATGAAATGGTAATATTTTATTGGTTTAATTGACTTAATAT
TATTATTCATTTAAATAAACAACAAAAAAGTAGAATTTAAATATTAATCAAGTTCAATCA
ATTTATAATTATAAGCATTAATTTGTCATTAAATAAAACATGGCTTTGAATCTTTATATG
AAAAATTGCATTTGTGTCTTTAATTTAAAAAAAATTTATTTAATAATTCATATTTTAATT
TAAATTAGTAAATTCAACACCCCACTGCTGCCATGATTGCTCGTTCTGCCACTGCTCAAG
ATGATATTGTCGGTGATGGTACCACCTCTAACGTCCTCTTCATTGGTGAAATGATGAAAT
AAGCTCAAAGATTAATTCAAGATGGTATCCACCCCAGAACTATTACTGATGGTTACGAAG
CTGCCAAGCACGAATCTCTTAAGTTCTTAGACGAATTCAAGTAAAACCTCACTGAATCAT
AAATCGACAAGGCTTTCCTTCTTTCTGTCGCTAGAACTTCTTTGAACACTAAGCTCCACC
CTGATATTGCTAACTAGTATGCCAAATTTTATTTTATATTTTTTTTTAAAAAGAATCAAG
CTAGAAACCAAAAAGAATGAAAATTAAGCATATATTAAGAATAATAATTTTATTTCAGAA
ACTAATTTTATTTTTTAATAATGTAGATTGGTTGAAATAGTCGTTGACTCCGTTCTTTGC
ATCAAGCAATAAGATAAACCTATTGATTTACATATGGTTGAAATTATGCACATGGTTCAC
AAGCTCTCTACTGATACTAGATTAGTTAAGGGTTTAGTTTTAGATCATGGTGCTCGTCAT
GCTGATATGCCCAAGAAACTTAAGAACTGTTACATTCTTAATTGCAACGTTTCTTTAGAA
TACGAAAAGACTGAAGTCCACTCTGGTTTCTTCTATTCCAACGCTGCTGACAGAGAAAAG
TTGATGCTTTCTGAACGTAAATTCACTGATGAAAGATGCCAAAAGATTATTGACCTCAAG
AGAAAGGTTTGCGAAGACCCCTCTAAGTCCTTTGTTGTTCTCAACTAAAAGGGTATTGAC
CCCATTTGCCTTGATATGTTTGCTAAGGAAAATATCATCGCTTTGAGAAGAACAAAGAGA
AGAAACATGGAAAGAATCATTCTTGCTTGTGGTGGTAACGGTGTTAACTCCGTTGAAGAT
TTATCTGAAGCTGATCTTGGTTGGGCTGATGAAGTTTATGAACACACTTTGGGTGAAGAA
AAGTACACTTTCATTGAAGGTGTCAAGAATCCCAAGTCATGCACCATTCTTATCAAGGGA
CCTAACGAGCACACTATTGCTCAAATTAAGGTAATTAATCATATAAATTATTTTAATACA
TGTTTTTAAATTATTATTTTTATTAAATTATAGGAAGCTATCAGAGATGGTTTAAGAGCT
GTTAAAAACGTTTTTGATGACAAGTGCGTTATCCCTGGTGCTGGTGCTTTTGAAATTGGT
GCTTACTGCCATTTACAAAAGTTCAAGGATTCCGTTAAGGGTAAGGCTAAATTAGGTGTT
GAAGCCTTTGCTGAATCTTTACTCATCATCCCCAAGATTTTAGCTGAAAACTGCGGTTAT
GATGTTTAAGATACAATCCTTGAAGTTATCGATGAATATAAAGCCAAGTAAGTTCCTGTT
GGTATCAACTGCAACGAAAAGGGTACTATTTCTCCTGTTGCTTCTGCTATTTATGATAAC
TATATTGCCAAGAAGCAATTCTTACATATGGCTCCTACTCTTGCCCAATAACTCCTTCTT
GTTGACGAAGTAAATATATTAAATTAAATAAATTTTTAACATGATTTAATAAAAAATTTT
ATAAAAAATAGATCATGAGAGCTGGTAAATAGATGGGTGGTGGTAATTGA


>TTHERM_00670500(protein)
MSNVQYVNSKAEVLKKFQALAMNIHAAVGLQEVMRSNLGPKGTLKMLVGGAGQIKLTKDG
SVLLHEMQIQHPTAAMIARSATAQDDIVGDGTTSNVLFIGEMMKQAQRLIQDGIHPRTIT
DGYEAAKHESLKFLDEFKQNLTESQIDKAFLLSVARTSLNTKLHPDIANQLVEIVVDSVL
CIKQQDKPIDLHMVEIMHMVHKLSTDTRLVKGLVLDHGARHADMPKKLKNCYILNCNVSL
EYEKTEVHSGFFYSNAADREKLMLSERKFTDERCQKIIDLKRKVCEDPSKSFVVLNQKGI
DPICLDMFAKENIIALRRTKRRNMERIILACGGNGVNSVEDLSEADLGWADEVYEHTLGE
EKYTFIEGVKNPKSCTILIKGPNEHTIAQIKEAIRDGLRAVKNVFDDKCVIPGAGAFEIG
AYCHLQKFKDSVKGKAKLGVEAFAESLLIIPKILAENCGYDVQDTILEVIDEYKAKQVPV
GINCNEKGTISPVASAIYDNYIAKKQFLHMAPTLAQQLLLVDEIMRAGKQMGGGN