Identifiers and Description

Gene Model Identifier

TTHERM_00672190

Standard Name

THD13 (Tetrahymena Histone Deacetylase 13)

Aliases

PreTt10965 | 101.m00120

Description

THD13 Sir2 family transcriptional regulator; Sir2-like histone deacetylase; suppresses DNA transcription by deacetylation of histones; homolog of Rattus norvegicus SIRT3

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00220 ) Neurohypophysial hormones, N-terminal Domain
  • ( PF01023 ) S-100/ICaBP type calcium binding domain
  • ( PF01344 ) kelch repeat protein
  • ( PF02146 ) transcriptional regulator, Sir2 family
  • ( PF04640 ) Protein of unknown function, DUF597
  • ( PF07646 ) kelch repeat protein

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_14307.1 9.997093137033517e-262
Description: hypothetical protein (944 aa)
Oxytricha Contig20663.0.g91 2.9992476920535046e-16
Description: Kelch motif
WormBase WBGene00002186 0.0002999184360822198
Description: locus:kel-10 Kelch repeat-containing protein kel-10 status:Confirmed UniProt:P34569 protein_id:CAA83141.3

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:18178773: Smith JJ, Torigoe SE, Maxson J, Fish LC, Wiley EA (2008) A class II histone deacetylase acts on newly synthesized histones in Tetrahymena. Eukaryotic cell 7(3):471-82

Sequences

>TTHERM_00672190(coding)
ATGATTGATAACTAAAGCGTAAACTAAGAGGGGCAGAACATTTCTTATTCTTGCTAAATT
AGCAATTGCCCAATTAGTAAAAATGGAAACTTTAATGAAGGAGATATTAAATTTTGCACT
GATTGCAATAAACTAATATGCAACACTTGCATAACTAGTCATGATGAAAACCACACCATT
ATTGAAGGTGCTAATTTCGCTTTCATTCAAGAGAATATGTCCAAAGTCCTTCCTAATTTA
GGGAATCTGAGCCCAATTTTGCAAAGTAATAACTTAAATATAAGTAGTGATTCTAAGATG
ATAAGTGAAGATACTCTTCCTGATACAGAGGAAAAAAAAGTTTAAGAGAAATAGAATTTT
AACTATAAATAGCAGCCTTAGTTTTTATAAAAAATAAACGACGATGATGATGAGGATGAT
GATGATAGTGATAGTGATGACGATGATCATATTATGAAAATGAAAAATTTCAGCAATATT
GCTGCATAACTTAAAAATTTAAAAAATGACAGTGATGAAGAAGAGGAGGATGATGAAGAT
GATGATGAAATAAACTTTATAAGCCAAGCTGCAAGTAAATTAACTACTATAGGAAAAGTA
TCTAACTCACCAACAAATACTATGTTTGTAGAATATAACACAAAACCTCCAAGTGAAAAT
CAATTTGATTTTAATTAATAACAATAAATAAATAATGCGAGCTATAAATAGTCAGGTATA
ATGAATGGTACAAACTTTCTTTAAGTTCCTCAAGATTTTAATAATGTAAAACGTATAATC
AACTAAAATTCTTACTAGAATAACAATTATTCAATTAATATAAATGGAGCGAATGGATAT
CAAAACCAGGAATTTAACTCAAACAAATTGTATTAAAATCAGTATGCTCTAACAGAGCTG
TAGAAGGTCTTTTTATAAAAAGAAAAATATTACAATTTGGTGAGCTAGTTTTACAAATAA
AACAAACCAAATAAGAATTTAGTTACTAAAAAGATAGCAGCACAATAAATAAAGAAAAAA
AGAAAAGCTAAAGATGATTTGGGTGGCGATAATGAAAATGATGAAAGTAAAAATTAAGAA
TAAGAAGATATTCCTATTCCTCAAGTTTAAGACCATGTGAAAGAATCTAATAAGAAGTTA
GGGTTACAGGAATTAAAAAATCGTTCTAAGTAGCTCTATGAAGAATTAAAAGCTAAATCT
GATTTGATTTTTAAGGAAATAAAACACCACATTCATGGTGTTCAATACGAGAGAGATGAA
ACAGATAGAATTAATAAATATAAGAAATATGCTCTTGAAGGCATTGAGAGTTATTTCCTC
TATCTTAAAGACTAATTTAAAATTGAGTATTCTAAATTGAAGAAATGTAAAAAGAGAGAA
TAACTAAGTAAAATGATGAACAAAGTAATAGATTGTATAGAAAAATATCAATACTATTCG
GACTAGAAAGATTTTCTTGAATTTATGAACAAAAACTATGATTACTATTTGAATAATATT
GAATTACTCTTACATGAAATTTAAAAAGAGGGCAATGATTTCCCTCCTCAATATAAAATA
GTCTATGAAAATCTCTATGACATATTTTTCTCTCTTATAAGTTACATCTCATTGAACTTG
CCTAACTAAAAAACTTATAGTCAATTTACTTAACCCATAATAAAGACTTAAAGCTCGAAA
TATTTGGTCATCCCTATTCACTATCCAAATAAAAAAATAGTTGGAATATTTAACTGCAGA
AGTAACGAATTAGAATAAATCGAATATGATTGCTCTTAGACTATGGATTTCTAGAAGTAT
AGCAACTTTTAATTGGTTAATGATAGCGATTTTATTTACTTTATTGGAGGAGTAATATTT
AACAAAGAGAAGAGCACCTTTAATCCTAGTTAAAAGTGTTTCAAAATGAGTAGACATTCA
GGGGAAATTATAGCCCTAAAAGACATGCCTTATCCTAAAATGAAGTTTGGAACAATTATG
ATTGGTAATTTTATTTATGTTTTTGGAGGTTTACAAACTCAAGAAAAGCACCGTACCAAT
ACTTGTGAAAAATATGACATTAACACTAACACATGGAAAATATTACCTGTGATGCAAATG
AACAGAGTATGCCCAGTAGTCTCATCTTTCACCACTATAGGTAGTGGCTTTAATTAAAAG
CAATTAATTTACTTATTCGGTGGCATGGAAGACAAAAACAACATTAATTAATCTATTGAA
GTCTTCGACTAAAAGCTAGATATTTGGATTGACTTCTTATAAAAACCAGCAAATAGTAGA
TGCTATATCCCAAAACAACTTGGTTATGGAGTTTAAATTAATTAAGAATAAATCTTAATT
ATCGGAGGTTTATCTGGAAGAAAGCAAAAACCTACATCATAAACTTATGTGTATAATGTT
TCTAAAAATTCCATATGTAATTTAAGTTTAGACTCTTTACCAACAGGAATAATTAAAGAC
TCTTTCACTGGAATGCCTGTTGTTTATGATAACTCAATTTTCCTTCTTAACACTCAAATA
AGCTAATACTTCCCTTCACTAAAATAATTATAAGGAGTAACCAATGTTATAAAGATAGGA
TTGAATCAATAAGAAATTTTAGCAACTCATTGTTTTTGA


>TTHERM_00672190(gene)
ATGATTGATAACTAAAGCGTAAACTAAGAGGGGCAGAACATTTCTTATTCTTGCTAAATT
AGCAATTGCCCAATTAGTAAAAATGGAAACTTTAATGAAGGAGATATTAAATTTTGCACT
GATTGCAATAAACTAATATGCAACACTTGCATAACTAGTCATGATGAAAACCACACCATT
ATTGAAGGTGCTAATTTCGCTTTCATTCAAGAGAATATGTCCAAAGTCCTTCCTAATTTA
GGGAATCTGAGCCCAATTTTGCAAAGTAATAACTTAAATATAAGTAGTGATTCTAAGATG
ATAAGTGAAGATACTCTTCCTGATACAGAGGAAAAAAAAGTTTAAGAGAAATAGAATTTT
AACTATAAATAGCAGCCTTAGTTTTTATAAAAAATAAACGACGATGATGATGAGGATGAT
GATGATAGTGATAGTGATGACGATGATCATATTATGAAAATGAAAAATTTCAGCAATATT
GCTGCATAACTTAAAAATTTAAAAAATGACAGTGATGAAGAAGAGGAGGATGATGAAGAT
GATGATGAAATAAACTTTATAAGCCAAGCTGCAAGTAAATTAACTACTATAGGAAAAGTA
TCTAACTCACCAACAAATACTATGTTTGTAGAATATAACACAAAACCTCCAAGTGAAAAT
CAATTTGATTTTAATTAATAACAATAAATAAATAATGCGAGCTATAAATAGTCAGGTATA
ATGAATGGTACAAACTTTCTTTAAGTTCCTCAAGATTTTAATAATGTAAAACGTATAATC
AACTAAAATTCTTACTAGAATAACAATTATTCAATTAATATAAATGGAGCGAATGGATAT
CAAAACCAGGAATTTAACTCAAACAAATTGTATTAAAATCAGTATGCTCTAACAGAGCTG
TAGAAGGTCTTTTTATAAAAAGAAAAATATTACAATTTGGTGAGCTAGTTTTACAAATAA
AACAAACCAAATAAGAATTTAGTTACTAAAAAGATAGCAGCACAATAAATAAAGAAAAAA
AGAAAAGCTAAAGATGATTTGGGTGGCGATAATGAAAATGATGAAAGTAAAAATTAAGAA
TAAGAAGATATTCCTATTCCTCAAGTTTAAGACCATGTGAAAGAATCTAATAAGAAGTTA
GGGTTACAGGAATTAAAAAATCGTTCTAAGTAGCTCTATGAAGAATTAAAAGCTAAATCT
GATTTGATTTTTAAGGAAATAAAACACCACATTCATGGTGTTCAATACGAGAGAGATGAA
ACAGATAGAATTAATAAATATAAGAAATATGCTCTTGAAGGCATTGAGAGTTATTTCCTC
TATCTTAAAGACTAATTTAAAATTGAGTATTCTAAATTGAAGAAATGTAAAAAGAGAGAA
TAACTAAGTAAAATGATGAACAAAGTAATAGATTGTATAGAAAAATATCAATACTATTCG
GACTAGAAAGATTTTCTTGAATTTATGAACAAAAACTATGATTACTATTTGAATAATATT
GAATTACTCTTACATGAAATTTAAAAAGAGGGCAATGATTTCCCTCCTCAATATAAAATA
GTCTATGAAAATCTCTATGACATATTTTTCTCTCTTATAAGTTACATCTCATTGAACTTG
CCTAACTAAAAAACTTATAGTCAATTTACTTAACCCATAATAAAGACTTAAAGCTCGAAA
TATTTGGTCATCCCTATTCACTATCCAAATGTAATGTTTGTTTCTATTACTTGAAATATC
CTTTCGAATTCAAAAGAAAATATTTTAGAAATATCTAACAAAAGCTATTTTGAATAAAAA
ATAATTTTAAAAAAATTAATTTAAAAATTTTTAATTTTAAAGAAAAAAATAGTTGGAATA
TTTAACTGCAGAAGTAACGAATTAGAATAAATCGAATATGATTGCTCTTAGACTATGGAT
TTCTAGAAGTATAGCAACTTTTAATTGGTTAATGATAGCGATTTTATTTACTTTATTGGA
GGAGTAATATTTAACAAAGAGAAGAGCACCTTTAATCCTAGTTAAAAGTGTTTCAAAATG
AGTAGACATTCAGGGGAAATTATAGCCCTAAAAGACATGCCTTATCCTAAAATGAAGTTT
GGAACAATTATGATTGGTAATTTTATTTATGTTTTTGGAGGTTTACAAACTCAAGAAAAG
CACCGTACCAATACTTGTGAAAAATATGACATTAACACTAACACATGGAAAATATTACCT
GTGATGCAAATGAACAGAGTATGCCCAGTAGTCTCATCTTTCACCACTATAGGTAGTGGC
TTTAATTAAAAGCAATTAATTTACTTATTCGGTGGCATGGAAGACAAAAACAACATTAAT
TAATCTATTGAAGTCTTCGACTAAAAGCTAGATATTTGGATTGACTTCTTATAAAAACCA
GCAAATAGTAGATGCTATATCCCAAAACAACTTGGTTATGGAGTTTAAATTAATTAAGAA
TAAATCTTAATTATCGGAGGTAATAAATAAATTTATTTATTTCAAATAATTAAACAACTC
ATTGAATTTTTATTTAAAAATGTTTTTTAAATTAATTAGGTTTATCTGGAAGAAAGCAAA
AACCTACATCATAAACTTATGTGTATAATGTTTCTAAAAATTCCATATGTAATTTAAGTT
TAGACTCTTTACCAACAGGAATAATTAAAGACTCTTTCACTGGAATGCCTGTTGTTTATG
ATAACTCAATTTTCCTTCTTAACACTCAAATAAGCTAATACTTCCCTTCACTAAAATAAT
TATAAGGAGTAACCAATGTTATAAAGATAGGATTGAATCAATAAGAAATTTTAGCAACTC
ATTGTTTTTGA


>TTHERM_00672190(protein)
MIDNQSVNQEGQNISYSCQISNCPISKNGNFNEGDIKFCTDCNKLICNTCITSHDENHTI
IEGANFAFIQENMSKVLPNLGNLSPILQSNNLNISSDSKMISEDTLPDTEEKKVQEKQNF
NYKQQPQFLQKINDDDDEDDDDSDSDDDDHIMKMKNFSNIAAQLKNLKNDSDEEEEDDED
DDEINFISQAASKLTTIGKVSNSPTNTMFVEYNTKPPSENQFDFNQQQQINNASYKQSGI
MNGTNFLQVPQDFNNVKRIINQNSYQNNNYSININGANGYQNQEFNSNKLYQNQYALTEL
QKVFLQKEKYYNLVSQFYKQNKPNKNLVTKKIAAQQIKKKRKAKDDLGGDNENDESKNQE
QEDIPIPQVQDHVKESNKKLGLQELKNRSKQLYEELKAKSDLIFKEIKHHIHGVQYERDE
TDRINKYKKYALEGIESYFLYLKDQFKIEYSKLKKCKKREQLSKMMNKVIDCIEKYQYYS
DQKDFLEFMNKNYDYYLNNIELLLHEIQKEGNDFPPQYKIVYENLYDIFFSLISYISLNL
PNQKTYSQFTQPIIKTQSSKYLVIPIHYPNKKIVGIFNCRSNELEQIEYDCSQTMDFQKY
SNFQLVNDSDFIYFIGGVIFNKEKSTFNPSQKCFKMSRHSGEIIALKDMPYPKMKFGTIM
IGNFIYVFGGLQTQEKHRTNTCEKYDINTNTWKILPVMQMNRVCPVVSSFTTIGSGFNQK
QLIYLFGGMEDKNNINQSIEVFDQKLDIWIDFLQKPANSRCYIPKQLGYGVQINQEQILI
IGGLSGRKQKPTSQTYVYNVSKNSICNLSLDSLPTGIIKDSFTGMPVVYDNSIFLLNTQI
SQYFPSLKQLQGVTNVIKIGLNQQEILATHCF