Identifiers and Description

Gene Model Identifier

TTHERM_00678250

Standard Name

FRS3 (Phenylalanyl(F)-tRNA Synthetase 3)

Aliases

PreTt07589 | 102.m00109 | 3730.m00036

Description

FRS3 phenylalanine-tRNA ligase; Phenylalanyl-tRNA synthetase family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00152 ) tRNA synthetases class II (D,
  • ( PF01409 ) phenylalanyl-tRNA synthetase
  • ( PF03147 ) Ferredoxin-fold anticodon binding domain
  • ( TIGR00468 ) phenylalanyl-tRNA synthetase, alpha subunit
  • ( TIGR00469 ) phenylalanyl-tRNA synthetase

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_16392.1 9.997093137033517e-262
Description: phenylalanyl-tRNA synthetase (419 aa)
Oxytricha Contig16741.0.g68 1.9999788875029746e-125
Description: tRNA synthetases class II core domain (F)
DictyBase DDB_G0274371 1.9992982665753866e-121
Description: mpheS on chromosome: 2 position 3786786 to 3788150
SGD YPR047W 5.000729663236884e-95
Description: MSF1 Mitochondrial phenylalanyl-tRNA synthetase, active as a monomer, unlike the cytoplasmic subunit which is active as a dimer complexed to a beta subunit dimer; similar to the alpha subunit of E. coli phenylalanyl-tRNA synthetase
WormBase WBGene00013361 1.0002434920975502e-91
Description: locus:fars-2 status:Confirmed UniProt:G5EEN1 protein_id:CBM41247.1
Stentor Coeruleus SteCoe_18970 1.5400882849875202e-51
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00678250(coding)
ATGATATTAGCAAGATAGTTAAATAATTTTATTAAGCTAAACAAGAGAAACTTAATTGCA
ACTACCTTATGTTTCTCTTATTAAAAACATTTTTCTAGTGTTACTGAGTAAATTCGTAAA
GAAATCGAAGAAAAAAAATCACCTTATGGCAATATTACTCCAAAGATTATAGAGTTAGCA
GGCCAAGAGTTGTATAAGCAACCTAACCATCCTTTAGGAATTATGCGTTATAAGATGGAA
GAATTTTTTACAAATGACAAATATAAGAAGGGCTTTTTGCATGAAAAGAAAAAGTTTCCT
TTCGTAATTGGAGATAGTTTCTCTCCTGTAATCAGTGTTCAGTAGAACTTCGAAGATCTT
CTCATCCCAAAAGATCATGTTTCTCGTAAAAGATCAGATACTTACTATATTTCTGAAAAT
TACATTATGAGACCATAAGCAACTGCAAATGAGCGTAACATGTTTGAACAAAAAGCTGAA
GCTTTCGTTATTTTTGCTGATTGCTTTAGAAGAGACGAGATAGATGCAACACATTACCCT
GTTTTCCATTAAATGGAAGTTGTTAGAGCATACACTCAAGATTACTTTGATACTAAGAAT
GAAGATATTAAAATATAAATGGTTATGAAGGATCTTTAAGAAACATATGAGAGTTTAGTC
AGAAATATTTTTGGTGAAGATGTTTAATATAGATGGATACCAGCTTATTTCCCATTCACG
GAACCTTCTTTGGAAATGGAAATATATTTCAATGGAGAATGGGTAGAAATGTTTGGATGT
GGTATCCTTCGTAAAGAAATTATGAAAAACTTCGGAAGACATGATGATGATATTGCATGG
GCATCAGGTGGTGGCTTAGAAAGATTCGCAATGCTTCTTTTTGGCATTCCTGATATTAGA
CTTTTCTGGAGTAAAGATTCTAGATTTTTGAATCAATTTAAGGCTGGACAAATTAACAAA
TTTTAGCCATTCAGTAAATATCCTGCTTGCTATAAGGATATATCTTTTTGGATAAAAGAT
ATGACAACTTTTGAAGAAAATGATATTTATGAAATTGTGAGAGAAATTGGAGGTGATCTT
ATTGAATAGGTAGAGTGTGTTGACACCTATGAGAATAAAAAGACTGGGAAAACTAGCAAA
TGCTTTAGAATAAATTACAGATCATTAGAAAGAACTCTTACAAATTAAGAAATTGACACC
TTATAATTCTCCATTAGAGATGAAATCAAAAATAAATTAGGTTATGAATTAAGATGA


>TTHERM_00678250(gene)
ATGATATTAGCAAGATAGTTAAATAATTTTATTAAGCTAAACAAGAGAAACTTAATTGCA
ACTACCTTATGTTTCTCTTATTAAAAACATTTTTCTAGTGTTACTGAGTAAATTCGTAAA
GAAATCGAAGAAAAAAAATCACCTTATGGCAATATTACTCCAAAGATTATAGAGTTAGCA
GGCCAAGAGTTGTATAAGCAACCTAACCATCCTTTAGGAATTATGCGTTATAAGATGGAA
GAATTTTTTACAAATGACAAATATAAGAAGGGCTTTTTGCATGAAAAGAAAAAGTTTCCT
TTCGTAATTGGAGATAGTTTCTCTCCTGTAATCAGTGTTCAGTAGAACTTCGAAGATCTT
CTCATCCCAAAAGATCATGTTTCTCGTAAAAGATCAGATACTTACTATATTTCTGAAAAT
TACATTATGAGACCATAAGCAACTGCAAATGAGCGTAACATGTTTGAACAAAAAGCTGAA
GCTTTCGTTATTTTTGGTAATTACTTTATTTTGTTATTTAAGAATTATAATAGAAATTGT
CATTAGATTTATTTAAAATGCAAGATTATCTCTATCAAATTCATATTATAAAAGAAATAA
TATTCAAGATGTTATGTATTTTAAATTAAAATTTTTTTTTATAAAATATAAGCTGATTGC
TTTAGAAGAGACGAGATAGATGCAACACATTACCCTGTTTTCCATTAAGTAATATATAAC
TAATAAATCGAAAAAGAGAAAATAAAATAAACTTATAGAATCAAGATTGAACTTTTTCTT
AATAAGAATTAATTAAATATTTAAATGAAAATAAATTCAACAAAAAATATTCTATTCAGC
AATAAATTTAATCAATTTAATGTAATTAACTAATTTTGTATCATATTAAAGATGGAAGTT
GTTAGAGCATACACTCAAGATTACTTTGATACTAAGAATGAAGATATTAAAATATAAATG
GTTATGAAGGATCTTTAAGAAACATATGAGAGTTTAGTCAGAAATATTTTTGGTGAAGAT
GTTTAATATAGATGGATACCAGCTTATTTCCCATTCACGGAACCTTCTTTGGAAATGGAA
ATATATTTCAATGGAGAATGGGTAGAAATGTTTGGATGTGGTATCCTTCGTAAAGAAATT
ATGAAAAACTTCGGAAGACATGATGATGATATTGCATGGGCATCAGGTGGTGGCTTAGAA
AGATTCGCAATGCTTCTTTTTGGCATTCCTGATATTAGGTTATTTATTAATTTAAAATTA
TACTAAAATAAGTTTATTTGCCTACTAACAAAAGTTTAATCTTTTGGATGGATAAATCTA
CTTTTAGAATAATAAAAAGTTAAAAATATCGTTTGATTTAATTTAATTATTTTTATTTCT
ATAGACTTTTCTGGAGTAAAGATTCTAGATTTTTGAATCAATTTAAGGCTGGACAAATTA
ACAAATTTTAGCCATTCAGTAAATATCCTGCTTGCTATAAGGATATATCTTTTTGGATAA
AAGATATGACAACTTTTGAAGAAAATGATATTTATGAAATTGTGAGAGAAATTGGAGGTG
ATCTTATTGAATAGGTAGAGTGTGTTGACACCTATGAGAATAAAAAGACTGGGAAAACTA
GCAAATGCTTTAGAATAAATTACAGATCATTAGAAAGAACTCTTACAAATTAAGAAGTAA
AATTTTTATTTCGACCCATTTTAATTATCAATTAAATATCTTTTGAATATTTACTTGAAT
ATTTAATTAATGTCGTTTTTAGTTTTTAGGTTAAGATTGAATAAATAAAAAAATTTTTAT
TTATTTTTTTTATGCTAATAAAAAATAAGAATATTCTTTCGGCATAATAAATTTAATTGT
TAGTATAATAACCTAAATTAATTAATTAAGATTATTAAGAAGAACTTTCACAAACTCTGT
TCTAGCTTAACTTGTCGAATAATTTCTTCATTAACTTTTTTTTCTTAAAAATAGATTGAC
ACCTTATAATTCTCCATTAGAGATGAAATCAAAAATAAATTAGGTTATGAATTAAGATGA


>TTHERM_00678250(protein)
MILARQLNNFIKLNKRNLIATTLCFSYQKHFSSVTEQIRKEIEEKKSPYGNITPKIIELA
GQELYKQPNHPLGIMRYKMEEFFTNDKYKKGFLHEKKKFPFVIGDSFSPVISVQQNFEDL
LIPKDHVSRKRSDTYYISENYIMRPQATANERNMFEQKAEAFVIFADCFRRDEIDATHYP
VFHQMEVVRAYTQDYFDTKNEDIKIQMVMKDLQETYESLVRNIFGEDVQYRWIPAYFPFT
EPSLEMEIYFNGEWVEMFGCGILRKEIMKNFGRHDDDIAWASGGGLERFAMLLFGIPDIR
LFWSKDSRFLNQFKAGQINKFQPFSKYPACYKDISFWIKDMTTFEENDIYEIVREIGGDL
IEQVECVDTYENKKTGKTSKCFRINYRSLERTLTNQEIDTLQFSIRDEIKNKLGYELR