Identifiers and Description

Gene Model Identifier

TTHERM_00678260

Standard Name

TFA (Tetrahymena homolog of the liver F-Antigen)

Aliases

PreTt07590 | 102.m00110 | 3730.m00037

Description

TFA 4-hydroxyphenylpyruvate dioxygenase; Homolog of vertebrate liver F-antigen; constituent of the intracellular membrane network; associated with membranes of the Golgi apparatus and transport vesicles

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_16390.1 9.997093137033517e-262
Description: 4-hydroxyphenylpyruvate dioxygenase (434 aa)
Oxytricha Contig5080.0.g13 2.000147820282363e-173
Description: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily
WormBase WBGene00001993 9.996149531968772e-161
Description: locus:hpd-1 4-hydroxyphenylpyruvate dioxygenase status:Confirmed UniProt:Q22633 protein_id:CAA90315.1
DictyBase DDB_G0277511 2.998986826334339e-156
Description: hpd on chromosome: 2 position 8032660 to 8033990
Stentor Coeruleus SteCoe_22285 6.542840619051457e-69
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:1469718: Hummel R, Nørgaard P, Andreasen PH, Neve S, Skjødt K, Tornehave D, Kristiansen K (1992) Tetrahymena gene encodes a protein that is homologous with the liver-specific F-antigen and associated with membranes of the Golgi apparatus and transport vesicles. Journal of molecular biology 228(3):850-61

Sequences

>TTHERM_00678260(coding)
ATGAGTGAAAATAAAGATCACGTTGTTGTTGGATACACTGAAAAGCCTGTTGGTGAAAGA
CCTACTGGTGGTAAGTTCTTAGGTTATGATCACTTACATTTCTGGGTTGGTAATGCCAAG
CAAGCTGCAGGATGGTACACTTCTCGTTTTGGTTTCGAATACTATGCTTACAAGGGTTTG
GAAACTGGTAGCAGAGAAGTTGCAACTCACGTTGTCCGTAATAAATAAGGTGTCACTTTA
GCCTTCAGTACTCCCTATGGAAACGACAAGGACAACTAAAGGGAAATGAACTAACATTAA
AGTTTACACGGTGATGGTGTTAAGGATGTCGCTTTTGCTGTTGAAGACTGTCACTCTATT
TACAACAAGGCTATCTAAAGAGGTGCCAAGTGTGCTTATCCTCCTCAAGATTTGAAGGAC
GAACATGGTAGTGTCACTATTGCTGCAGTCCACACTTATGGTGAAGTTATTCACACATTT
ATCCAAAGAAATGACTATAAAGGTTTCTTCATGCCTGGATTTGTTGCTCACCCCTTAAAG
GACCCCCTTAACAATGTTCTTCCTGACATCAGCTACAACTATGTAGATCATATTGTTGGT
AACCAACCTGATAACATGATGACCTCTGCTGCTGACTGGTATGAAAAGACTTTGGACTTC
CACAGATTCTGGTCTGTTGATGACAGCATGATCCACACTGAATTCTCTTCCTTAAGATCT
ATTGTCATGACTGACTACGATTAAAAGATTAAAATGCCCATTAACGAACCTGCTGATGGA
AAGAGAAAATCATAAATCTAAGAATATATTGATTTCTATGCTGGCCCTGGTGTATAACAC
ATTGCCTTGAATACAAGTGATGTAATCAACACTGTCGAAGGTCTTAGAGCTAGAGGTGTT
GAATTTTTATCTATTCCTACTTCCTATTATGATAATCTCAGAAAGGCTCTTACTGCATAG
ACTTCTATCACTGTTAAGGAAGATCTTGATGTCTTACAAAAGAACCATATTTTAGTTGAT
TATGATGAAAAGGGTTACCTCTTATAAATCTTCACCAAGCCTGTTGAAGATAGACCTACT
CTCTTCTACGAAATCATTCAAAGAAATAACCATTAAGGATTCGGTGCTGGTAACTTCAAG
TCCTTGTTTGTCTCTTTGGAACTTGAATAAGAAAAGAGAGGAAACCTTACTGAAATTGTC
AAGAACATCTATTGA


>TTHERM_00678260(gene)
ATGAGTGAAAATAAAGATCACGTTGTTGTTGGATACACTGAAAAGCCTGTTGGTGAAAGA
CCTACTGGTGGTAAGTTCTTAGGTTATGATCACTTACATTTCTGGGTTGGTAATGCCAAG
CAAGCTGCAGGATGGTACACTTCTCGTTTTGGTTTCGAATACTATGCTTACAAGGGTTTG
GAAACTGGTAGCAGAGAAGTTGCAACTCACGTTGTCCGTAATAAATAAGGTGTCACTTTA
GCCTTCAGTACTCCCTATGGAAACGACAAGGACAACTAAAGGGAAATGAACTAACATTAA
AGTTTACACGGTGATGGTGTTAAGGATGTCGCTTTTGCTGTAATTTTAATTATCTAAATT
CTTTATCATAAATTAAAAAAGAAAAGCTAATGAAAAAATGATAATTTAACTTATATTTTA
TTAATAAGGTTGAAGACTGTCACTCTATTTACAACAAGGCTATCTAAAGAGGTGCCAAGT
GTGCTTATCCTCCTCAAGATTTGAAGGACGAACATGGTAGTGTCACTATTGCTGCAGTCC
ACACTTATGGTGAAGTTATTCACACATTTATCCAAAGAAATGACTATAAAGGTTTCTTCA
TGCCTGGATTTGTTGCTCACCCCTTAAAGGACCCCCTTAACAATGTTCTTCCTGACATCA
GCTACAACTATGTAGATCATATTGTTGGTAACCAACCTGTAAGATTAAATTTAAAAAAAA
TATTTTGAAGGAATAATTAATTCAGTAAAAAAAATGTTTAAATGGCTATCTTATAAGTAA
TCTACTACAAAACTCCCATCAAAGATGAAGAAATTTATTATTAAAGACAAATAGAACTTA
ATAAATACTTAAAAATAGCAAATAAAATCAATTTTAGAAATATTCTAAACATTTCTCTAG
AAAAAGTAAAAAAGAATAGCCATAAATTCAAGCGAGTAGTTAGTCATTCATAAATTTGAT
TAAAATACAAAAAGAGCAAATTTATAATTAAATAAATTAATTAATTAAATAGATGTATGT
ATTTAATAAAATGCTCATATTTTGTTTATTATAAATAGGATAACATGATGACCTCTGCTG
CTGACTGGTATGAAAAGACTTTGGACTTCCACAGATTCTGGTCTGTTGATGACAGCATGA
TCCACACTGAATTCTCTTCCTTAAGATCTATTGTCATGACTGACTACGATTAAAAGATTA
AAATGCCCATTAACGAACCTGCTGATGGAAAGAGAAAATCATAAATCTAAGAATATATTG
ATTTCTATGCTGGCCCTGGTGTATAACACATTGCCTTGAATACAAGTGATGTAATCAACA
CTGTCGAAGGTCTTAGAGCTAGAGGTGTTGAATTTTTATCTATTCCTACTTCCTATTATG
ATAATCTCAGAAAGGCTCTTACTGCATAGACTTCTATCACTGTTAAGGAAGATCTTGATG
TCTTACAAAAGAACCATATTTTAGTTGATTATGATGAAAAGGGTTACCTCTTATAAATCT
TCACCAAGCCTGTTGAAGATAGGTAAAAGATTTACTTCATTTATTATTTAGTTTTTAATT
TAGATTAGACTTTGAAATTCATCAAACTTTTCTGATGAATCTTCGAACAATTTTGATCAA
ACTAAACTTTTTCTAATATTTTTAATTAATTAATAAAAATAGACCTACTCTCTTCTACGA
AATCATTCAAAGAAATAACCATTAAGGATTCGGTGCTGGTAACTTCAAGTCCTTGTTTGT
CTCTTTGGAACTTGAATAAGAAAAGAGAGGAAACCTTACTGAAATTGTCAAGAACATCTA
TTGA


>TTHERM_00678260(protein)
MSENKDHVVVGYTEKPVGERPTGGKFLGYDHLHFWVGNAKQAAGWYTSRFGFEYYAYKGL
ETGSREVATHVVRNKQGVTLAFSTPYGNDKDNQREMNQHQSLHGDGVKDVAFAVEDCHSI
YNKAIQRGAKCAYPPQDLKDEHGSVTIAAVHTYGEVIHTFIQRNDYKGFFMPGFVAHPLK
DPLNNVLPDISYNYVDHIVGNQPDNMMTSAADWYEKTLDFHRFWSVDDSMIHTEFSSLRS
IVMTDYDQKIKMPINEPADGKRKSQIQEYIDFYAGPGVQHIALNTSDVINTVEGLRARGV
EFLSIPTSYYDNLRKALTAQTSITVKEDLDVLQKNHILVDYDEKGYLLQIFTKPVEDRPT
LFYEIIQRNNHQGFGAGNFKSLFVSLELEQEKRGNLTEIVKNIY