Identifiers and Description

Gene Model Identifier

TTHERM_00678540

Standard Name

CTH25 (CaTHepsin 25)

Aliases

PreTt07618 | 102.m00138 | 3730.m00065

Description

CTH25 eukaryotic aspartyl protease

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF00026 ) Eukaryotic aspartyl protease

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_16358.1 1.9998298245723724e-130
Description: hypothetical protein (1125 aa)
Oxytricha Contig3196.0.g105 5.002171138422328e-22
Description: Eukaryotic aspartyl protease
WormBase WBGene00000216 2.0004286606204839e-16
Description: locus:asp-3 Aspartic protease 3 status:Confirmed UniProt:P55956 protein_id:CCD72415.2
SGD YPL154C 9.997764199084386e-16
Description: PEP4 Vacuolar aspartyl protease (proteinase A), required for the posttranslational precursor maturation of vacuolar proteinases; important for protein turnover after oxidative damage; synthesized as a zymogen, self-activates
Stentor Coeruleus SteCoe_13704 0.000000000005109089028063325
Description: None
DictyBase DDB_G0279411 0.0000000029989608248573072
Description: ctsD on chromosome: 3 position 2104523 to 2105867

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00678540(coding)
ATGATAATTAAACAAATAGTAACCTTTGCTTTGCTTTTAATACTAAGCAAGGCGGAAATC
ATAAAAATTCAACTCAAAAAATAGACAATAACCTAACTTGATTATTTATAATAAGATTCA
AACATATTATAACATGGCGGTAATAGTAGATATTTACAATAATCATCATAAGGCTCTAAA
TAAAATGTTGATTTAGCTAATTACCTTTAATAATAATATTCGGCAGAAATCACAATCGGA
AAGGGTAAAAAAACTTTATAAGTCCTTGTTGATACTGGCTCAAGTAAGCTCATGCTACCG
AGCAAGAACTGCATCGATAATAAAAATTGCAAGGGCTTCAATGCGTATTATGATTGTTTA
TCCTCAGATGGCTGCAATACCACAAATATAGAGTATACTTAAAACTACTTGACTGGATAA
GTGAATGGTGTCAATGTGAATGCAACAGTAGGAATAGCTAATTTATCTCAAATCTAACAA
TCTGTACTCTTGTTTGATGAATCTAATAAATTTACCAATGAATTCTCTGATGGCTTATTA
GGATTGTCAGTTTATAATAAAGATAACAATGGAAGCAATTCTTTCGTTACTAATCTCTAT
AAAAATGGTGTGATTCAAGAAAATATGTTCTCTTTGTATCTAGGATACAAATTGGATGAC
TCAGAACTTGTTTTGGGAGGTTATAACTCTAAAAAGATAGATCCGTCTTCTAAAATTTAT
AACCATAAGATATTATAAAATTTACAATATGACGATTCGTAGAAATGGGTTATTCCAGTA
TAAAGAATTGAATTAAATACTTTTTCCAAAACACTTTCTTCATAAAATAACCTGGCGATT
ATTGACTCTTCCTATCCTTATCTGGGAGTAGAACAAAGTATGTATTAAGGTATGGTAGAC
TATTTTGTTAAGAAAGGAGCTAAGCTAATAAACAATAAATATCAAATCGAATGCAACAAA
ACTCTTGATGATATATAATTCACTATCACGGATTCTGATTAAGTAGGAAGGATTTATTCT
CTTCCTTTTTCATTTTACACTTCAAACTCATCAAATACATGCACTTTTTTAATTTAATCT
TATAACGGAGCAAGTAATGTAGGTTTTGTGCTTGGAAATGCATTTCTAAGAAGATATGTT
TCAATCTTCTACTACTCAAATTTAACAGTTAGTTTTGGATAATCAACCGCAAACCCAAAT
GATGATTACACAAGTGGCTTACCCACATGGGCTATAGCTGTAATAGCTGCTGCTGCATCT
CTGTTTTCATTAGCAGGAGGATTTGCCTTATATAAAAAATGCAAAGGAAATAAAAATAGA
AGTGGCCTTACTTAAACTATGGTTAGCAATACATCTATTTGA


>TTHERM_00678540(gene)
ATGATAATTAAACAAATAGTAACCTTTGCTTTGCTTTTAATACTAAGCAAGGCGGAAATC
ATAAAAATTCAACTCAAAAAATAGACAATAACCTAACTTGATTATTTATAATAAGATTCA
AACATATTATAACATGGCGGTAATAGTAGATATTTACAATAATCATCATAAGGCTCTAAA
TAAAATGTTGATTTAGCTAATTACCTTTAATAATAATATTCGGCAGAAATCACAATCGGA
AAGGGTAAAAAAACTTTATAAGTCCTTGTTGATACTGGCTCAAGTAAGCTCATGCTACCG
AGCAAGAACTGCATCGATAATAAAAATTGCAAGGTAAAATAACAAAATAGAATTTTATTT
AGATGATAATTTTTTATAAACTAAGGGCTTCAATGCGTATTATGATTGTTTATCCTCAGA
TGGCTGCAATACCACAAATATAGAGTATACTTAAAACTACTTGACTGGATAAGTGAATGG
TGTCAATGTGAATGCAACAGTAGGAATAGCTAATTTATCTCAAATCTAACAATCTGTACT
CTTGTTTGATGAATCTAATAAATTTACCAATGAATTCGTATTAACAATTAATTATCTTTC
CTTTAATTAGAAAAAAAAGCATGTTATATAAATTTAATTTAATTTTTAATTTTTTAGTAT
TTGAAGATGCTTTTTCTGATATTTTATGATTATTGAAATTCTTATTTTAATTTTATTTAA
CATAGTCTGATGGCTTATTAGGATTGTCAGTTTATAATAAAGATAACAATGGAAGCAATT
CTTTCGTTACTAATCTCTATAAAAATGGTGTGATTCAAGAAAATATGTTCTCTTTGTATC
TAGGATACAAATTGGATGACTCAGAACTTGTTTTGGGAGGTTATAACTCTAAAAAGATAG
ATCCGTCTTCTAAAATTTATAACCATAAGATATTATAAAATTTACAATATGACGATTCGT
AGAAATGGGTTATTCCAGTATAAAGAATTGAATTAAATACTTTTTCCAAAACACTTTCTT
CATAAAATAACCTGGCGATTATTGACTCTTCCTATCCTTATCTGGGAGTAGAACAAAGTA
TGTATTAAGGTATGGTAGACTATTTTGTTAAGAAAGGAGCTAAGCTAATAAACAATAAAT
ATCAAATCGAATGCAACAAAACTCTTGATGATATATAATTCACTATCACGGATTCTGATT
AAGTAGGAAGGATTTATTCTCTTCCTTTTTCATTTTACACTTCAAACTCATCAAATACAT
GCACTTTTTTAATTTAATCTTATAACGGAGCAAGTAATGTAGGTTTTGTGCTTGGAAATG
CATTTCTAAGAAGATATGTTTCAATCTTCTACTACTCAAATTTAACAGTTAGTAACCTTA
AAAAATTTTAGTCTAATTAACATTAAAAAATTTCATCTTAAATTAATAGGTTTTGGATAA
TCAACCGCAAACCCAAATGATGATTACACAAGTGGCTTACCCACATGGGCTATAGCTGTA
ATAGCTGCTGCTGCATCTCTGTTTTCATTAGCAGGAGGATTTGCCTTATATAAAAAATGC
AAAGGAAATAAAAATAGAAGTGGCCTTACTTAAACTATGGTTAGCAATACATCTATTTGA


>TTHERM_00678540(protein)
MIIKQIVTFALLLILSKAEIIKIQLKKQTITQLDYLQQDSNILQHGGNSRYLQQSSQGSK
QNVDLANYLQQQYSAEITIGKGKKTLQVLVDTGSSKLMLPSKNCIDNKNCKGFNAYYDCL
SSDGCNTTNIEYTQNYLTGQVNGVNVNATVGIANLSQIQQSVLLFDESNKFTNEFSDGLL
GLSVYNKDNNGSNSFVTNLYKNGVIQENMFSLYLGYKLDDSELVLGGYNSKKIDPSSKIY
NHKILQNLQYDDSQKWVIPVQRIELNTFSKTLSSQNNLAIIDSSYPYLGVEQSMYQGMVD
YFVKKGAKLINNKYQIECNKTLDDIQFTITDSDQVGRIYSLPFSFYTSNSSNTCTFLIQS
YNGASNVGFVLGNAFLRRYVSIFYYSNLTVSFGQSTANPNDDYTSGLPTWAIAVIAAAAS
LFSLAGGFALYKKCKGNKNRSGLTQTMVSNTSI