Identifiers and Description

Gene Model Identifier

TTHERM_00681750

Standard Name

PCP1 (PARP Correlated Protein 1)

Aliases

PreTt16112 | 103.m00103 | 3734.m00016

Description

Poly polymerase and DNA-Ligase Zn-finger region family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00645 ) Poly(ADP-ribose) polymerase and DNA-Ligase Zn-finger
  • ( PF08063 ) PADR1 (NUC008) domain

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_14722.1 6.0023901016598e-137
Description: poly polymerase and DNA-Ligase Zn-finger region family protein (324 aa)
Stentor Coeruleus SteCoe_10542 0.0000000000006914400106940203
Description: None
DictyBase DDB_G0291872 0.00006000996057121373
Description: DDB_G0291872 on chromosome: 6 position 855161 to 857960

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00681750(coding)
ATGAGCGCGAAAGAATTAAAGTTTGATTATGCAAGCTCAAGTAGAGCTGGATGCAAAGGA
TGTAAAATGAAAATTTAAAAAAATGAGCTTAGAATAGGATTAGAAACTCTCTTTTAAGGT
GAGCATACAACGACTTCATGGAGACATTTAGAATGCTTTAGTCTTGGTAGAAAATATAAA
GATATTGATCCTAAAGAAATTGAAGGTTATTATGATTTAAAAAAGGAAGATAAAGCTAGG
GTAATAGATTACTTTGAAGGAGGTGGTCAAAAAAAATCTGTAGTTGATAAACTGATATCT
ACAATAACAGATTCAGAAAAGAAAAAAAAATAAGACGATGATGGTGATGACAATCAAGTT
TATGATTACGATGCTGAATAATAGAAGAAGAAAAATTAATAGTAAAAAGAAAAGAAAAAA
ATTACTAAACCTAAATTAAAAAGAAAGCTATCAAGTTCTTCAGAAGAGGAAGATGATTCG
TCTGATTCAGAAGATGATTTTGATGACTCAGAGACTGATAACTCAGGTAGTGATAGTGAT
TATGAAAAAGAAAAAGCTATCTAAAGAAAAAATCAACATAAAAAATTAGCAAGAAAAAAA
AAATCAAAAGGAAAAAGTAAAAGCAGCACTGAAATAAATATTGGTTACACTCCTGAATAG
TTACTTAAATTCAAAGAAAATTTAAAATTATATGAAAAAAAAACTGCAGAATACTTAAAG
GCTTTATTAGGAATTAACAATTAGCCTAAAACTGGTACAAAGGATGAATTAGTTTTGAAA
TGCGCAGATGGTAAAACACTTGGACAAATTCCAATATGTTCTGAGTGTGGTGGAGGGAAA
TTAAGGTATGATATATAAACTGGTATTTACAAATGTCCTGGATATATGGATGATGATGTT
TTTTAGCATTGTGGTAAAAAATTTACAAATGAATAAATTGTCAGATTACCTTGGATTGAT
GATATTATTTGA


>TTHERM_00681750(gene)
ATGAGCGCGAAAGAATTAAAGTTTGATTATGCAAGCTCAAGTAGAGCTGGATGCAAAGGA
TGTAAAATGAAAATTTAAAAAAATGAGCTTAGAATAGGATTAGAAACTCTCTTTTAAGGT
GAGCATACAACGACTTCATGGAGACATTTAGAATGCTTTAGTCTTGGTAGAAAATATAAA
GATATTGATCCTAAAGAAATTGAAGGTTATTATGATTTAAAAAAGGAAGATAAAGCTAGG
GTAATAGATTACTTTGAAGGAGGTGGTCAAAAAAAATCTGTAGTTGATAAACTGATATCT
ACAATAACAGATTCAGAAAAGAAAAAAAAATAAGACGATGATGGTGATGACAATCAAGTT
TATGATTACGATGCTGAATAATAGAAGAAGAAAAATTAATAGTAAAAAGAAAAGAAAAAA
ATTACTAAACCTAAATTAAAAAGAAAGCTATCAAGTTCTTCAGAAGAGGAAGATGATTCG
TCTGATTCAGAAGATGATTTTGATGACTCAGAGACTGATAACTCAGGTAGTGATAGTGAT
TATGAAAAAGAAAAAGCTATCTAAAGAAAAAATCAACATAAAAAATTAGCAAGAAAAAAA
AAATCAAAAGGAAAAAGTAAAAGCAGCACTGAAATAAATATTGGTTACACTCCTGAATAG
TTACTTAAATTCAAAGAAAATTTAAAATTATATGAAAAAAAAACTGCAGAATACTTAAAG
GCTTTATTAGGAATTAACAATTAGCCTAAAACTGGTACAAAGGATGAATTAGTTTTGAAA
TGCGCAGATGGTAAAACACTTGGACAAATTCCAATATGTTCTGAGTGTGGTGGAGGGAAA
TTAAGGTATGATATATAAACTGGTATTTACAAATGTCCTGGATATATGGATGATGATGTT
TTTTAGCATTGTGGTAAAAAATTTACAAATGAATAAATTGTCAGATTACCTTGGATTGAT
GATATTATTTGA


>TTHERM_00681750(protein)
MSAKELKFDYASSSRAGCKGCKMKIQKNELRIGLETLFQGEHTTTSWRHLECFSLGRKYK
DIDPKEIEGYYDLKKEDKARVIDYFEGGGQKKSVVDKLISTITDSEKKKKQDDDGDDNQV
YDYDAEQQKKKNQQQKEKKKITKPKLKRKLSSSSEEEDDSSDSEDDFDDSETDNSGSDSD
YEKEKAIQRKNQHKKLARKKKSKGKSKSSTEINIGYTPEQLLKFKENLKLYEKKTAEYLK
ALLGINNQPKTGTKDELVLKCADGKTLGQIPICSECGGGKLRYDIQTGIYKCPGYMDDDV
FQHCGKKFTNEQIVRLPWIDDII