Identifiers and Description

Gene Model Identifier

TTHERM_00683010

Standard Name

PLA1 (PhosphoLipase A)

Aliases

PreTt16138 | 103.m00129 | 3734.m00041

Description

PLA1 papain family cysteine protease; Lysosomal phospholipase A1; extracellular enzyme that may be secreted into the environment as part of an attack and defense system

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00112 ) Papain family cysteine protease
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_17791.1 9.997093137033517e-262
Description: papain family cysteine protease containing protein (322 aa)
Oxytricha Contig322.1.g116 9.995951036711152e-55
Description: Papain family cysteine protease
DictyBase DDB_G0283867 2.9994376937714457e-52
Description: cprC on chromosome: 4 position 1092858 to 1094270
WormBase WBGene00000776 2.000704504372864e-47
Description: locus:cpl-1 status:Confirmed UniProt:O45734 protein_id:CAB07275.1
Stentor Coeruleus SteCoe_2628 1.462486227251231e-31
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:11030577: Hartmann M, Guberman A, Florin-Christensen M, Tiedtke A (2000) Screening for and characterization of phospholipase A1 hypersecretory mutants of Tetrahymena thermophila. Applied microbiology and biotechnology 54(3):390-6
  2. Ref:10063621: Guberman A, Hartmann M, Tiedtke A, Florin-Christensen J, Florin-Christensen M (1999) A method for the preparation of Tetrahymena thermophila phospholipase A1 suitable for large-scale production. Journal of applied microbiology 86(2):226-30

Sequences

>TTHERM_00683010(coding)
ATGAACAAGACTCTCATCTTAGCTTTAGTTGGTGTTTTGGCTTTAACTGCCACCACCTTG
GTTGCTTTCCACAACCACTCTCACAACATCAGAGTTGACTAAGACCCCGCCACTCTCTTC
AAGCAATTCAAGCAAACTTACAATAAGAAGTATGCTGATCCTACTTTCGAAACCTACAGA
TTCGGTGTCTTCACCCAAAACTTAGAAATCGTCAAGACTGACTCTACTTTCGGTGTCACC
TAATTCATGGACTTAACTCCTGCTGAATTCGCTCAACAATTCCTCACTTTACACGAAAAG
GTTAACAGCACCGAAGTTTACAGAGCTTAAGGTGAAGCTACCGAAGTTGACTGGACTGCC
AAGGGTAAGGTCACCCCTGTTAAGAACTAAGGTTCTTGTGGTTCCTGCTGGGCTTTCTCC
ACCATTGGTGCCGTTGAATCTGCTCTTTTGATTGCTGGTCAAGGTGAATAAAACACTCTT
AACCTTGCTGAATAAGAATTAGTTGACTGTGCTAAGTCCCCCAAGTACGACTCTGAAGGT
TGCAACGGTGGTTGGATGGTTGAAGGTTTCAAGTACATCATCGACAACAAGATCTCCTAA
ACTGCTAACTATCCCTACACTGCTAAGGATGGTAAGTGCAAGGACACCTCTTCCTTCAAG
AAGTTCTCTATTTCTAAGTACGCTGAAATCCCCTAAGGTGACTGCAACTCCCTCAACTCT
GCCTTAGAACAAGGTCCTATCTCCGTTGCTGTTGATGCCACCAACTTCTAATTCTACACT
TCTGGTGTCTTTAAAAACTGCAAGGCCAACCTCAACCACGGTGTCCTCTTAGTTGCCAAC
GTTGACTCTTCTCTCAAGATCAAGAACTCCTGGGGTCCTTCTTGGGGTGAAAAGGGTTTC
ATCAGATTAGCTGCCGGTAACACTTGCGGTGTCTGCAATGCTGCCTCTTACCCTATTGTT
TGA


>TTHERM_00683010(gene)
ATGAACAAGACTCTCATCTTAGCTTTAGTTGGTGTTTTGGCTTTAACTGCCACCACCTTG
GTTGCTTTCCACAACCACTCTCACAACATCAGAGTTGACTAAGACCCCGCCACTCTCTTC
AAGCAATTCAAGCAAACTTACAATAAGAAGTATGCTGATCCTACTTTCGAAACCTACAGA
TTCGGTGTCTTCACCCAAAACTTAGAAATCGTCAAGACTGACTCTACTTTCGGTGTCACC
TAATTCATGGACTTAACTCCTGCTGAATTCGCTCAACAATTCCTCACTTTACACGAAAAG
GTTAACAGCACCGAAGTTTACAGAGCTTAAGGTGAAGCTACCGAAGTTGACTGGACTGCC
AAGGGTAAGGTCACCCCTGTTAAGAACTAAGGTTCTTGTGGTTCCTGCTGGGCTTTCTCC
ACCATTGGTGCCGTTGAATCTGCTCTTTTGATTGCTGGTCAAGGTGAATAAAACACTCTT
AACCTTGCTGAATAAGAATTAGTTGACTGTGCTAAGTCCCCCAAGTACGACTCTGAAGGT
TGCAACGGTGGTTGGATGGTTGAAGGTTTCAAGTACATCATCGACAACAAGATCTCCTAA
ACTGCTAACTATCCCTACACTGCTAAGGATGGTAAGTGCAAGGACACCTCTTCCTTCAAG
AAGTTCTCTATTTCTAAGTACGCTGAAATCCCCTAAGGTGACTGCAACTCCCTCAACTCT
GCCTTAGAACAAGGTCCTATCTCCGTTGCTGTTGATGCCACCAACTTCTAATTCTACACT
TCTGGTGTCTTTAAAAACTGCAAGGCCAACCTCAACCACGGTGTCCTCTTAGTTGCCAAC
GTTGACTCTTCTCTCAAGATCAAGAACTCCTGGGGTCCTTCTTGGGGTGAAAAGGGTTTC
ATCAGATTAGCTGCCGGTAACACTTGCGGTGTCTGCAATGCTGCCTCTTACCCTATTGTT
TGA


>TTHERM_00683010(protein)
MNKTLILALVGVLALTATTLVAFHNHSHNIRVDQDPATLFKQFKQTYNKKYADPTFETYR
FGVFTQNLEIVKTDSTFGVTQFMDLTPAEFAQQFLTLHEKVNSTEVYRAQGEATEVDWTA
KGKVTPVKNQGSCGSCWAFSTIGAVESALLIAGQGEQNTLNLAEQELVDCAKSPKYDSEG
CNGGWMVEGFKYIIDNKISQTANYPYTAKDGKCKDTSSFKKFSISKYAEIPQGDCNSLNS
ALEQGPISVAVDATNFQFYTSGVFKNCKANLNHGVLLVANVDSSLKIKNSWGPSWGEKGF
IRLAAGNTCGVCNAASYPIV