Identifiers and Description

Gene Model Identifier

TTHERM_00683060

Standard Name

CTH115 (CaTHepsin 115)

Aliases

PreTt16143 | 103.m00134 | 3734.m00046

Description

CTH115 papain family cysteine protease

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF00112 ) Papain family cysteine protease
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_17796.1 9.997093137033517e-262
Description: papain family cysteine protease containing protein (322 aa)
Oxytricha Contig322.1.g116 6.002077021906841e-60
Description: Papain family cysteine protease
DictyBase DDB_G0290957 7.996547841088611e-53
Description: cprA on chromosome: 5 position 4812963 to 4814596
WormBase WBGene00000776 1.0004249259458435e-52
Description: locus:cpl-1 status:Confirmed UniProt:O45734 protein_id:CAB07275.1
Stentor Coeruleus SteCoe_25185 3.975449735908647e-31
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00683060(coding)
ATGAGCTAAAAAATTACTGTTACTCTTGTTGCTATCGCTGCTATTGCCGCTATCACTGCT
GCTGGCATTTACTACTAGAACCACTAAGCTAGCCAATTAGAAAAGTCTTTCAAGAGAAAT
ACCATCCTTGAATAATGGAACGAATTCAAGCAAAAGTTTGGTAAGAAATATGCTGACTAA
GAATTCGAAAGATACAGAATCGGAGTTTTCGCTCAAAATTTAGAAGTTATCAAGAACGAT
CCTTCCTTCGGTGTTACCAAGTTCATGGATATGACCCCATAAGAATTCGAACAATCCTAC
TTATCTCTCTAACTCCAACAAAACTTCAATGCTGAAAAGGTTGATGGTGACTTTAATGGT
GATATTGATTGGACTTAAAAGGGTGCTGTTACTCCTGTCAAGGACTAAGGTTCTTGCGGT
TCTTGCTGGGCTTTCTCTGCTATCGGAGCTGTTGAATCTGCTTTGATCTTGAACGGTGAA
GACAAGAACATCAATTTGGCTGAATAAGAATTGGTCGACTGTGCTACTACTCCCAAGTAC
GAAAATGAAGGTTGCAACGGTGGTTGGATGGACTCTGCTTTCGACTACATTATTGATGAA
AAGATCTCTTAAACCAAGGACTACAAGTACACTGCTAGAGACGGCAAGTGCAAGGATACC
TCATCTTTTGAAAAGAAGTCTATCTCTGGATACAAGGACATTCCTCAAGGTGACTGCAAG
TCTCTCTTAAACGCTCTTTCCTAATAACCCGTTGCTATTGCAGTTGATGCTTCTTCTTGG
TAATTCTACAACAAGGGAGTTTTATCATCCTGTGGCAGCAGACTTAATCACGGTGTTTTA
TTAACTGGTTACGTTAACGAAACTTACAAGGTTAAGAACTCTTGGGGTACTTCTTGGGGT
GAAAAGGGTTTCATCTAATTAAAGTCAGGTAACTCTTGTGGTCTCTGCAATGCTGCCTCT
TACCCTCTTGCTTGA


>TTHERM_00683060(gene)
ATGAGCTAAAAAATTACTGTTACTCTTGTTGCTATCGCTGCTATTGCCGCTATCACTGCT
GCTGGCATTTACTACTAGAACCACTAAGCTAGCCAATTAGAAAAGTCTTTCAAGAGAAAT
ACCATCCTTGAATAATGGAACGAATTCAAGCAAAAGTTTGGTAAGAAATATGCTGACTAA
GAATTCGAAAGATACAGAATCGGAGTTTTCGCTCAAAATTTAGAAGTTATCAAGAACGAT
CCTTCCTTCGGTGTTACCAAGTTCATGGATATGACCCCATAAGAATTCGAACAATCCTAC
TTATCTCTCTAACTCCAACAAAACTTCAATGCTGAAAAGGTTGATGGTGACTTTAATGGT
GATATTGATTGGACTTAAAAGGGTGCTGTTACTCCTGTCAAGGACTAAGGTTCTTGCGGT
TCTTGCTGGGCTTTCTCTGCTATCGGAGCTGTTGAATCTGCTTTGATCTTGAACGGTGAA
GACAAGAACATCAATTTGGCTGAATAAGAATTGGTCGACTGTGCTACTACTCCCAAGTAC
GAAAATGAAGGTTGCAACGGTGGTTGGATGGACTCTGCTTTCGACTACATTATTGATGAA
AAGATCTCTTAAACCAAGGACTACAAGTACACTGCTAGAGACGGCAAGTGCAAGGATACC
TCATCTTTTGAAAAGAAGTCTATCTCTGGATACAAGGACATTCCTCAAGGTGACTGCAAG
TCTCTCTTAAACGCTCTTTCCTAATAACCCGTTGCTATTGCAGTTGATGCTTCTTCTTGG
TAATTCTACAACAAGGGAGTTTTATCATCCTGTGGCAGCAGACTTAATCACGGTGTTTTA
TTAACTGGTTACGTTAACGAAACTTACAAGGTTAAGAACTCTTGGGGTACTTCTTGGGGT
GAAAAGGGTTTCATCTAATTAAAGTCAGGTAACTCTTGTGGTCTCTGCAATGCTGCCTCT
TACCCTCTTGCTTGA


>TTHERM_00683060(protein)
MSQKITVTLVAIAAIAAITAAGIYYQNHQASQLEKSFKRNTILEQWNEFKQKFGKKYADQ
EFERYRIGVFAQNLEVIKNDPSFGVTKFMDMTPQEFEQSYLSLQLQQNFNAEKVDGDFNG
DIDWTQKGAVTPVKDQGSCGSCWAFSAIGAVESALILNGEDKNINLAEQELVDCATTPKY
ENEGCNGGWMDSAFDYIIDEKISQTKDYKYTARDGKCKDTSSFEKKSISGYKDIPQGDCK
SLLNALSQQPVAIAVDASSWQFYNKGVLSSCGSRLNHGVLLTGYVNETYKVKNSWGTSWG
EKGFIQLKSGNSCGLCNAASYPLA