Identifiers and Description

Gene Model Identifier

TTHERM_00683070

Standard Name

RRM43 (RNA recognition motif-containing protein 43)

Aliases

PreTt16144 | 103.m00135 | 3734.m00047

Description

RRM43 RNA-binding domain protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,
  • ( PF06513 ) Repeat of unknown function (DUF1103)
  • ( PF07813 ) LTXXQ motif
  • ( TIGR01622 ) splicing factor, CC1-like family

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_17797.1 9.997093137033517e-262
Description: RNA binding domain-containing protein (566 aa)
Oxytricha Contig18138.0.g75 7.001141985045207e-89
Description: RNA recognition motif_ (a_k_a_ RRM, RBD, or RNP domain)
DictyBase DDB_G0289547 1.999981404597394e-31
Description: DDB_G0289547 on chromosome: 5 position 2930859 to 2932103
WormBase WBGene00022025 1.000382677035467e-28
Description: status:Confirmed UniProt:Q9BL57 protein_id:CCD71919.1
SGD YNL286W 1.000116773704384e-19
Description: CUS2 Protein that binds to U2 snRNA and Prp11p, may be involved in U2 snRNA folding; contains two RNA recognition motifs (RRMs)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00683070(coding)
ATGGAGGAATTTATTTGGTATTATGCAGATAGTTAAGCTCTGTAAGAGAGAACACCTATA
GGACCTGTTAGCATTAGAGATTTAGATGTTTTGTATAGGACTTCAGCAATAAATTCTGCA
ACTTATGTTTGGAAAGAAGGTATGCCTGAATGGGTTTAACTTTTTAAAGTATAGGAATTG
AAGGAGGCTATTCTAGACGAGCAATAAGATATTAAGGTAATATAAGAACTTTATGAAAAG
TAGTAGCAGGAACTAGCTCTAGCTAATTAAAAGGGTAAAAAGTAATAGAAAATACAAGAT
AAACTTGACAAAAAATAAGCTTAGATTGATCAAAAGTTGCTTGAGGAAGCTAAATATAAT
TAATCAATGAATAGTGGCAAGGAGGAAGATATAAGTCAAGATTAGGTAAAATAAAACTTG
GAATTGTTATAGCAAATAGATGAAGAAGAAGTGTTAGATGAAGATGAAGAAGAAGAAAGG
GAGTATTTAAAGCTGTTATAAGAAAATCCAGAAGAAGCGATTTAAAGAATGGCCAATAAC
ACTTTAAACAGCTATTTTTACTATTCTGAAGATGATAAAAAGTGGAATATTTGTAGAGAA
GATGAAAATAATGAGAGAGTTTGGATCTAATAAGATGAAGAACCTAAAGAAGAAATGGAT
AAAATGAGAAATGAATTGATAGAAAAGCTTAGAAAATAATTTATAGGTGAAGAAAACAAA
GATATTGAGACATTGAAAAGCAATTTGAAAGATCAGCTATAAATGTAAAATGATATTGAA
GATAATAACGCTGATCCTAAAGATAAAGAAATTATGAAAGGTATGACAGCAGAGCAAATT
AAAAAGATAAAACGTAACAAAAAGAAAGCCAAAAGATAAGCTGAAAAAAAGAAATAGAAA
TGGTATTAATCTAGGGTTAATACATATATATATGTAAAGGGATTGCCTCTTTCTATTACA
GAAGAAAAACTCGATGAATTCTTTTCCAGAGCAGGAGTAATTAGAAAGGACCCAATCACC
AATAAAAAAAAGATCAAAATTTACTCGGATGAAAACGGTCTCCCTAAAGGTGATGCAGTT
ATCAGCTTTTAGATGATGGAATCTGTAGAAATTGCAATTACTATGCTTGATGAGAGAGAA
ATAGAACCAGGCCATATTATTAGGGTCGAAAGAGCTAATTTTGAATAGCATGGAGATACT
TATAAGAAAAGAGAAGGTGTTGTTATTAACAAAGAAAAAGCTTTGGATAAAATTTAACTT
GCCTAAATGAAAGCTGCTCAAAGATAGGCTCTGGGTTGGGAAGATGAAGACCAAATTGAC
ACAGGACTTAAAATTGTCATATTAAAAAATGTATTTACTCTTAAGGATATAGAAGAAGAT
CCAAATTTCTTGGAAGAACTCAGAGAAGAAATGGCTAAAGAGATAGAGTCAACTTGTGGA
CCAATTTAGAGATTAAAAATATTTGAAGAAAATCCAGAAGGAGTTATTGAAATTAAATTT
AAAAATTCTGCTGATGCCAAGGTTTGCATTCAAAAAATGGATGGTAGATATTTTGATGAG
AGAGAACTTGAGTGCTTTTTCTGGGATGGTAAGGTAGATTACAAAAGGTCTTAAAAACAA
ATGGAAGATGACGAATAAAGACTTGAAGAATTTGGTAAATGGATAGAAGGAGGTGATAAT
AATAATTCAGAAAATGGTTAAAAATAAATTAGTTGA


>TTHERM_00683070(gene)
ATGGAGGAATTTATTTGGTATTATGCAGATAGTTAAGCTCTGTAAGAGAGAACACCTATA
GGACCTGTTAGCATTAGAGATTTAGATGTTTTGTATAGGACTTCAGCAATAAATTCTGCA
ACTTATGTTTGGAAAGAAGGTATGCCTGAATGGGTTTAACTTTTTAAAGTATAGGAATTG
AAGGAGGCTATTCTAGACGAGCAATAAGATATTAAGGTAATATAAGAACTTTATGAAAAG
TAGTAGCAGGAACTAGCTCTAGCTAATTAAAAGGGTAAAAAGTAATAGAAAATACAAGAT
AAACTTGACAAAAAATAAGCTTAGATTGATCAAAAGTTGCTTGAGGAAGCTAAATATAAT
TAATCAATGAATAGTGGCAAGGAGGAAGATATAAGTCAAGATTAGGTAAAATAAAACTTG
GAATTGTTATAGCAAATAGATGAAGAAGAAGTGTTAGATGAAGATGAAGAAGAAGAAAGG
GAGTATTTAAAGCTGTTATAAGAAAATCCAGAAGAAGCGATTTAAAGAATGGCCAATAAC
ACTTTAAACAGCTATTTTTACTATTCTGAAGATGATAAAAAGTGGAATATTTGTAGAGAA
GATGAAAATAATGAGAGAGTTTGGATCTAATAAGATGAAGAACCTAAAGAAGAAATGGAT
AAAATGAGAAATGAATTGATAGAAAAGCTTAGAAAATAATTTATAGGTGAAGAAAACAAA
GATATTGAGACATTGAAAAGCAATTTGAAAGATCAGCTATAAATGTAAAATGATATTGAA
GATAATAACGCTGATCCTAAAGATAAAGAAATTATGAAAGGTATGACAGCAGAGCAAATT
AAAAAGATAAAACGTAACAAAAAGAAAGCCAAAAGATAAGCTGAAAAAAAGAAATAGAAA
TGGTATTAATCTAGGGTTAATACATATATATATGTAAAGGGATTGCCTCTTTCTATTACA
GAAGAAAAACTCGATGAATTCTTTTCCAGAGCAGGAGTAATTAGAAAGGACCCAATCACC
AATAAAAAAAAGATCAAAATTTACTCGGTAATTAATTTAAGGGGTATTATGTAAGTAATA
TCATAATAATAATAAGTTTATAAAACAAAATACTTCCTTTTAAAAGCAATTAATTTATTT
CTTAAATAACTAATCTTACTTTTAAGTAGAATGATTCTACACCATCAAAGAGTTGTTGCA
TTTTACCTTACTTCAAAAAATTACAACATTTATTAGCAACTTATTTTTATTAAGATGTTA
AAATTAGTTTAATATTTGAGATTAATTGCTGTTATTATTATTTTATGACATTTAAATATT
TATTATTTATTTTATAATTAGGATGAAAACGGTCTCCCTAAAGGTGATGCAGTTATCAGC
TTTTAGATGATGGAATCTGTAGAAATTGCAATTACTATGCTTGATGAGAGAGAAATAGAA
CCAGGCCATATTATTAGGGTCGAAAGAGCTAATTTTGAATAGCATGGAGATACTTATAAG
AAAAGAGAAGGTGTTGTTATTAACAAAGAAAAAGCTTTGGATAAAATTTAACTTGCCTAA
ATGAAAGCTGCTCAAAGATAGGCTCTGGGTTGGGAAGATGAAGACCAAATTGACACAGGA
CTTAAAATTGTCATATTAAAAAATGTATTTACTCTTAAGGATATAGAAGAAGATCCAAAT
TTCTTGGAAGAACTCAGAGAAGAAATGGCTAAAGAGATAGAGTCAACTTGTGGACCAATT
TAGAGATTAAAAATATTTGAAGAAAATCCAGAAGGAGTTATTGAAATTAAATTTAAAAAT
TCTGCTGATGCCAAGGTTTGCATTCAAAAAATGGATGGTAGATATTTTGATGAGAGAGAA
CTTGAGTGCTTTTTCTGGGATGGTAAGGTAGATTACAAAAGGTCTTAAAAACAAATGGAA
GATGACGAATAAAGACTTGAAGAATTTGGTAAATGGATAGAAGGAGGTGATAATAATAAT
TCAGAAAATGGTTAAAAATAAATTAGTTGA


>TTHERM_00683070(protein)
MEEFIWYYADSQALQERTPIGPVSIRDLDVLYRTSAINSATYVWKEGMPEWVQLFKVQEL
KEAILDEQQDIKVIQELYEKQQQELALANQKGKKQQKIQDKLDKKQAQIDQKLLEEAKYN
QSMNSGKEEDISQDQVKQNLELLQQIDEEEVLDEDEEEEREYLKLLQENPEEAIQRMANN
TLNSYFYYSEDDKKWNICREDENNERVWIQQDEEPKEEMDKMRNELIEKLRKQFIGEENK
DIETLKSNLKDQLQMQNDIEDNNADPKDKEIMKGMTAEQIKKIKRNKKKAKRQAEKKKQK
WYQSRVNTYIYVKGLPLSITEEKLDEFFSRAGVIRKDPITNKKKIKIYSDENGLPKGDAV
ISFQMMESVEIAITMLDEREIEPGHIIRVERANFEQHGDTYKKREGVVINKEKALDKIQL
AQMKAAQRQALGWEDEDQIDTGLKIVILKNVFTLKDIEEDPNFLEELREEMAKEIESTCG
PIQRLKIFEENPEGVIEIKFKNSADAKVCIQKMDGRYFDERELECFFWDGKVDYKRSQKQ
MEDDEQRLEEFGKWIEGGDNNNSENGQKQIS