Identifiers and Description

Gene Model Identifier

TTHERM_00684450

Standard Name

PRP5 (pre-mRNA processing factor 5)

Aliases

PreTt18158 | 104.m00090 | 3732.m00004

Description

PRP5 Pre-mRNA-splicing factor prp46; pre-mRNA processing factor

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00400 ) WD domain, G-beta repeat
  • ( PF08946 ) Osmosensory transporter coiled coil

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_17333.1 9.997093137033517e-262
Description: hypothetical protein (552 aa)
Oxytricha Contig20238.0.g39 2.0001055857497602e-161
Description: WD domain, G-beta repeat
DictyBase DDB_G0279507 1.99904246446894e-143
Description: plrg1 on chromosome: 3 position 2174875 to 2176510
WormBase WBGene00006481 1.9995317320402142e-140
Description: locus:plrg-1 status:Confirmed UniProt:G5ECP2 protein_id:CBW48353.1
SGD YPL151C 2.000808864924972e-124
Description: PRP46 Member of the NineTeen Complex (NTC) that contains Prp19p and stabilizes U6 snRNA in catalytic forms of the spliceosome containing U2, U5, and U6 snRNAs
Stentor Coeruleus SteCoe_31078 1.4411565509640892e-64
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00684450(coding)
ATGGCTGGGATCGATCAATTAATCAACTAAGAGATATCAGACTTTACTTTAGATTCTGTT
TATAATAGTAAAAAAATGTTTATGAGCAATTTGGGCTTGAAAGTGCCTGATTTCATTGAA
AGTACTAGATTAAAATTATAAGTTAAGATTAATGATGAGTATAAATTTGCTTATGATAAG
TAGATAAAAGAGGCTTAAAAATAAGAGGAGCAAGATATCCTCAAGCTTGCAGAATAATTT
TATGATTAATCAACAGAAAGTAATGTCCTTCTTAACGAGCAAGTCCAAAAAATGCAAGAA
GAAAAGAAAATCAAGGAATTAAATGCTTAGAAAAGAAGCAATATCGAAGTAGTAATTGAA
TAAATACCTGAAAAGCAAATTGAAATTAATAAAAAGTTATCAAAACTCCCAGCTTCTTTC
CTAAAATATGGATAAAAGGCTGGATTAGATAGTCAAACTTTAGAAAAGAAAAAGGAAGAA
GAAAGACTTATGCTTACTTATTCAGGATCAGCATCTACTGCTAATAATTAATTATTATCA
TAAAGTGAGAGAGATGCTTCTAAATATCAAATAGCTAATCTATCTACTGATAACTATGTT
AAAGGAGGTGAAGTTATTGATACTGTTAGAATGGGATCTGCTATCGCAAGAAATATTACA
AAGGTTATTAAGCCTGAGTGGCATAAACCTTGGAAATTAATGAGAGTTATTGCTGGCCAC
AGAGGTTGGGTTAGGTGCGTAACTATAGATCCTGCAAATTAATTCTTTGTTACAGGATCA
AACGATAGAACAATTAAATTCTGGGATTTAGCCTCAGGATAATTGAAATTAACCCTAACT
GGCCACACATCTCCCGTTAGAGCTTTAGTAGTATCTGACAGACATCCTTACTTGTTCTCT
GCAGCCGAAGATAAAACTGTTCGTTGCTGGGATCTTGAAATGAATTAAGTCATCAGAAAC
TATCACGGACATTTATCAAGTGTTCATTCTATTTGCATTCACCCTACTTTAAACTTAATT
GCAACTGGTGGCAGAGATTGTACAATTAGATTATGGGATATAAGAGCAAGATCGTAGGTA
CATGTTTTAACTGGACATTAGCATGCTGTAGGAACTGTTATAAGTTAAGAATTTGAACCT
TAAATAGTATCAGGCTCTTATGATAATTATATTAAAACTTGGGATATTGCAGCAGGAAAA
TGTATGAAAACATTGACAAACCATAAGAAACCTGTAAAGTCTTTAGTTTTTCACCATAAA
GAATACACATTTGCTTCAGGTGCAGCTGATAATATCAAGGTTTGGAAGTGTCCCGAAGGA
GAATTTTTAAGAAATATATCATCTGGAAATGATCATATAGTAAATTCAATTGCTTTAAAT
TAGGATAATGTACTCGTTAGCGGTTGTGATGATGGTACTCTCAAATTTTGGGACTGGAAA
TCAGGATATAATTTCTAAACAATTAAATAAAAGCCATAACCTGGTTCTATAGCTGCAGAA
AATGCTATTTTTGATATGAAATTTGATAGATCATAAATGAGACTAATCACTGCTGAGTGT
GATAAAACTATAAAAGTTTATAAGGAAGATGATGAAGCTACAATGGAATCTCATCCAATA
AATGATTTTAAAGTAGAATATGGAAAGCAAGTTTATTGA


>TTHERM_00684450(gene)
ATGGCTGGGATCGATCAATTAATCAACTAAGAGATATCAGACTTTACTTTAGATTCTGTT
TATAATAGTAAAAAAATGTTTATGAGCAATTTGGGCTTGAAAGTGCCTGATTTCATTGAA
AGTACTAGATTAAAATTATAAGTTAAGATTAATGATGAGTATAAATTTGCTTATGATAAG
TAGATAAAAGAGGCTTAAAAATAAGAGGAGCAAGATATCCTCAAGCTTGCAGAATAATTT
TATGATTAATCAACAGAAAGTAATGTCCTTCTTAACGAGCAAGTCCAAAAAATGCAAGAA
GAAAAGAAAATCAAGGAATTAAATGCTTAGAAAAGAAGCAATATCGAAGTAGTAATTGAA
TAAATACCTGAAAAGCAAATTGAAATTAATAAAAAGTTATCAAAACTCCCAGCTTCTTTC
CTAAAATATGGATAAAAGGCTGGATTAGATAGTCAAACTTTAGAAAAGAAAAAGGAAGAA
GAAAGACTTATGCTTACTTATTCAGGATCAGCATCTACTGCTAATAATTAATTATTATCA
TAAAGTGAGAGAGATGCTTCTAAATATCAAATAGCTAATCTATCTACTGATAACTATGTT
AAAGGAGGTGAAGTTATTGATACTGTTAGAATGGGATCTGCTATCGCAAGAAATATTACA
AAGGTTATTAAGCCTGAGTGGCATAAACCTTGGAAATTAATGAGAGTTATTGCTGGCCAC
AGAGGTTGGGTTAGGTGCGTAACTATAGATCCTGCAAATTAATTCTTTGTTACAGGATCA
AACGATAGAACAATTAAATTCTGGGATTTAGCCTCAGGATAATTGAAATTAACCCTAACT
GGCCACACATCTCCCGTTAGAGCTTTAGTAGTATCTGACAGACATCCTTACTTGTTCTCT
GCAGCCGAAGATAAAACTGTTCGTTGCTGGGATCTTGAAATGAATTAAGTCATCAGAAAC
TATCACGGACATGTAAATTAAATAATATTTATAAATTAATTTTAAAAGTTACTTGTTAAT
TTGAAAAAATGAATTAATTATAATGAATTTTATTTAAATTAGTTATCAAGTGTTCATTCT
ATTTGCATTCACCCTACTTTAAACTTAATTGCAACTGGTGGCAGAGATTGTACAATTAGA
TTATGGGATATAAGGTAGCATATTCAAAATTAAATTAGATATAAAATAATATTTTTTATC
TTAAAATAGAGCAAGATCGTAGGTACATGTTTTAACTGGACATTAGCATGCTGTAGGAAC
TGTTATAAGTTAAGAATTTGAACCTTAAATAGTATCAGGCTCTTATGATAATTATATTAA
AACTTGGGATATTGCAGCAGGAAAATGTATGAAAACATTGACAAACCATAAGAAACCTGT
AAAGTCTTTAGTTTTTCACCATAAAGAATACACATTTGCTTCAGGTGCAGCTGATAATAT
CAAGGTTTGGAAGTGTCCCGAAGGAGAATTTTTAAGAAATATATCATCTGGAAATGATCA
TATAGTAAATTCAATTGCTTTAAATTAGGATAATGTACTCGTTAGCGGTTGTGATGATGG
TAATTTAAGATTAAATTTTATCAATATTGATTAAAAAATAATTAAAATATAAAAGGTACT
CTCAAATTTTGGGACTGGAAATCAGGATATAATTTCTAAACAATTAAATAAAAGCCATAA
CCTGGTTCTATAGCTGCAGAAAATGCTATTTTTGATATGAAATTTGATAGATCATAAATG
AGGTAAGCTAAACAAACATAAAAAATTTTAATTTCTAATAATTATATTTTTAAAATAGAC
TAATCACTGCTGAGTGTGATAAAACTATAAAAGTTTATAAGGAAGATGATGAAGCTACAA
TGGAATCTCATCCAATAAATGATTTTAAAGTAGAATATGGAAAGCAAGTTTATTGA


>TTHERM_00684450(protein)
MAGIDQLINQEISDFTLDSVYNSKKMFMSNLGLKVPDFIESTRLKLQVKINDEYKFAYDK
QIKEAQKQEEQDILKLAEQFYDQSTESNVLLNEQVQKMQEEKKIKELNAQKRSNIEVVIE
QIPEKQIEINKKLSKLPASFLKYGQKAGLDSQTLEKKKEEERLMLTYSGSASTANNQLLS
QSERDASKYQIANLSTDNYVKGGEVIDTVRMGSAIARNITKVIKPEWHKPWKLMRVIAGH
RGWVRCVTIDPANQFFVTGSNDRTIKFWDLASGQLKLTLTGHTSPVRALVVSDRHPYLFS
AAEDKTVRCWDLEMNQVIRNYHGHLSSVHSICIHPTLNLIATGGRDCTIRLWDIRARSQV
HVLTGHQHAVGTVISQEFEPQIVSGSYDNYIKTWDIAAGKCMKTLTNHKKPVKSLVFHHK
EYTFASGAADNIKVWKCPEGEFLRNISSGNDHIVNSIALNQDNVLVSGCDDGTLKFWDWK
SGYNFQTIKQKPQPGSIAAENAIFDMKFDRSQMRLITAECDKTIKVYKEDDEATMESHPI
NDFKVEYGKQVY