Identifiers and Description

Gene Model Identifier

TTHERM_00684490

Standard Name

RTEL1 (homolog of Regulator of Telomere Elongation helicase 1)

Aliases

PreTt18162 | 104.m00094 | 3732.m00008

Description

DNA repair helicase (Rad3); DNA repair helicase (rad3)

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

  • negative regulation of protein kinase activity (IEA) | GO:0006469
  • porphyrin-containing compound catabolic process (IEA) | GO:0006787

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_17337.1 9.997093137033517e-262
Description: DNA repair helicase (rad3) (1051 aa)
Oxytricha Contig21447.0.g90 6.996820840887259e-117
Description: Helicase C-terminal domain
WormBase WBGene00009124 1.0003180480544985e-86
Description: locus:rtel-1 Regulator of telomere elongation helicase 1 homolog status:Confirmed UniProt:Q93575 protein_id:CAB02102.1
DictyBase DDB_G0286621 8.001058982644703e-42
Description: fncJ on chromosome: 4 position 4729555 to 4732791
SGD YER171W 9.99723014177113e-33
Description: RAD3 5 to 3 DNA helicase, involved in nucleotide excision repair and transcription; subunit of RNA polII initiation factor TFIIH and of Nucleotide Excision Repair Factor 3 (NEF3); homolog of human XPD protein; mutant has aneuploidy tolerance
Stentor Coeruleus SteCoe_28156 0.000000000000012664165549094176
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:23884606: Gao S, Xiong J, Zhang C, Berquist BR, Yang R, Zhao M, Molascon AJ, Kwiatkowski SY, Yuan D, Qin Z, Wen J, Kapler GM, Andrews PC, Miao W, Liu Y (2013) Impaired replication elongation in Tetrahymena mutants deficient in histone H3 Lys 27 monomethylation. Genes & development 27(15):1662-79

Sequences

>TTHERM_00684490(coding)
ATGAATCCAAACTATCCTTCAATTAAAGTTAAGTAGTTAGCTTACCAAAAGAAATTTATC
CAAAGATAAGATAGTTTCTCTTCCTAAACAAATGAAAACTCTCAATAAAGTAGTAAAAGT
TTTAGATCCAAAGATCCTGTTTTGGAGAATACACCTATTCATCTCAACATTTTGCATAAA
GATAAGCATACAAAACTAAATATAAACAATATTGAAGTTTATTTTCCTCATAAACCTTAT
GATGTTTAAGTAGTATACATGGAGAGTGTCATAAAATGTTTATAAGAAAGAACTCACGGT
TTATTAGAATCTCCGACTGGTACAGGAAAAACTTTATCTATGCTTTGTGCGTGTTTAGGA
TGGCTATAATAAAGGAGAGAGTAATAATAAGGAATTAAAGATATTATTCCAAATAGAATT
ATTTATTGCTCTAGAACTCATAGTTAAATATAGCAGGTAGTTAAAGAAATAAAAACAACA
GCTTATTAGCCAAAGATAATAGTGTAAGGTTCAAGAGAGCAGTATTGCATTAAGAAAGAA
TTTTAATAGTTGAAAGGAGGTCTACTAAATACTTCATGCTAAAAAGCAATTAGCCAACTT
AATCCACAAACTTACTGTAGATACTTTAAGGGAACTATGGATGAAAGCAGAGATTTTTTT
AAACTTAGAATGCCAGATATAGAGGACTTAAGAAGTGATGGATATAACAATAATTACTGT
CCCTTTTATCATACCTAGAAAGTTAACAATGCAGTAGATGTTCTTTTTCTTCCATATAAC
TATTTACTTGATAGAAATGTGATGAATTAAGCTAATATAAATATAAAAAACGCTGTAATT
ATATTTGATGAAGCTCACAATATACACAAATCAGCAGAAGAAGGTTATTCTTTGTTTTTA
AACTATTCTTCTTTGTGTGCTGCCGAAGCTGATTTGCTAAATCTTCTTAAGTATATTGAA
AATGGGTATGTAGATGACTAAAATAATTCAACTTCGCCTGCACCTTTAGGTGCTGCAAAA
AGAGGAACACCTATCAAAGAGTTAAGCGAATTCGACACAAAAAATTTTACTAGCTCCTCA
TTTGACTGTAAGGCAATGCTTGGGCCGATTTAGGAATTAAGAAATTATTTTAAACAAATG
GCCTTAAAATAGATAAGAGAAAATTAATAAAACTAGTATAATGAATACAACTGTGATAAT
ATTTAGATTTAGAATGGTAAAGACATATTCGAATTGATCTAAATCCATACAAGAACATCA
AAAGAATAAATTAATGAAAATTCTGTTGATAAATACATGAAGGCTCTTGATAAATAAAAA
GGCACATAATTTGTTTCATTTGAAAACGGATTGAGCTAAAGTAATTTAGCATAATATATA
GACAAAGCTTATAAAGCAATTAAAGACTTGAGTATAGGAGCTTCACATCATGGTCTAGAA
ACTTGGGTCAAATTCTTAGAAGGATTAAAAGATTTATGGACTAGTCACAATGAATTTAAT
TTAAAAACGAAAAAGTCAGACAATCCTTCATAGTTATGTTAAACTAATGATGTCATGCAA
GACTATAAGCTTTATTTTGATTTAGAAGATCCAGAAAATCCATAATTAAATCTTACTTGC
CTTAATCCCAGCTTGAATTTCAAAAAAATTCTTCAGTAAGATCCTCATTGCTTACTTTTT
ACCTCAGGAACATTAAAACCATTTAATTTTTGGAAGACTGAGTTGCAAATTCCATTTAAC
GTAATCCTTGAAAATAAGCATGTCATAGATTCGAAAAAGCAGCTTTTTTCTGCTGTGATA
AAAGGTAGACCTTCAAAATCATCTGTTATCACAACATATAAGCAAACCTTTAACTTTAGC
TATGAAAAAAGAAAGGATTAAGATATGATTTTAGATCTTGGTAATGCTCTAGCTGAACTT
TTTGAAATTATTCCGAATGGTGTTTTAATCGTTTTTCCATCAAATTAACTAATGAATTAG
TGTAGATCTTAATGGTCAAATTTCTTTTCTAATCAAAATAGCAACAATTAATAATAAAAA
ATATACAATCGCTTATTATCAAAGAAATTCATTTACTGGGAAGGAAAAACTAATACTGAA
ACAATGAGTGCTATGTAAGATTTTAGATAAAAGTCAAAAACGTAAAAAGGTTCTGCATTT
TTTTGTGTAGCAAGAGGTAAAATTACAGAAGGTATTGACTTTGCTGATGAATCTGCAAGA
GCAGTTATTTTAATAGGCTTACCATATCCTCCACTTAAAAATATCAATATATAAGTAAAA
AAAGACTATTTAAATCAATAAAGTAAATTAAATTCTTAAAGAATAAATGGAAATGAATGG
TATGTGCAAGAAGCCATCAGAGCGATGAATTAATCCATTGGAAGAGTAATTAGGCATATT
AACGACTGGGGAAGTGTTATATTTTTAGATGAAAGATTTGGACAATAAGATATAATAAAA
CACATGCCTTCTTGGTGCTTAACACAATAAATTGATTCATTTGATTAAGCTCTTATATAG
TTATCGCAATTTTTTAGTGAGAAAAAAATGGCCTCTAAATAAAAATAAGAGGAGCTAAGA
AAATAAATTAACTTAAAGAAAAAAGATAATTTAGAATTAGAATAAGCAGAATAATAATCA
TTTAGTAATACATAAAAACCATAACATGGTATTTAAGTAGTTTAAAAAAGGGCTTTTGAT
TTTACTTCTGTTAAAAGCTTATAAAATTAAATTTAGAAGCCTTAGAAACTTTTTAAATAA
AATATTTTAGTAAGCAAAGATGAGGAATCTCAAAAAAGTTACTAAACACTTGAAAAACCA
GTCTAAAATATAAAAAAGAATCCTTTTTGCTAATCATCTGATGATGAAGAAAACTAACCT
GAGTAAAAATTTTAAATAGTTAAACCTAGTTAATCAATAAAATAAGAAAATAATTAAAAT
ACTACTTCAAGCTAATTTGATTTTTCTAAGCCAATAAAAATAAAATCTTCTTAAGATAAA
ATTATGATTAAAAACGTCTCTTCTAATGTAAATAATTAACAAAATGTAATGAGTACAAAA
AATTCTATTTACACAAATAAAATATTTTTTGAATCTTGA


>TTHERM_00684490(gene)
ATGAATCCAAACTATCCTTCAATTAAAGTTAAGTAGTTAGCTTACCAAAAGAAATTTATC
CAAAGATAAGATAGTTTCTCTTCCTAAACAAATGAAAACTCTCAATAAAGTAGTAAAAGT
TTTAGATCCAAAGATCCTGTTTTGGAGAATACACCTATTCATCTCAACATTTTGCATAAA
GATAAGCATACAAAACTAAATATAAACAATATTGAAGTTTATTTTCCTCATAAACCTTAT
GATGTTTAAGTAGTATACATGGAGAGTGTCATAAAATGTTTATAAGAAAGAACTCACGGT
TTATTAGAATCTCCGACTGGTACAGGAAAAACTTTATCTATGCTTTGTGCGTGTTTAGGA
TGGCTATAATAAAGGAGAGAGTAATAATAAGGAATTAAAGATATTATTCCAAATAGAATT
ATTTATTGCTCTAGAACTCATAGTTAAATATAGCAGGTAGTTAAAGAAATAAAAACAACA
GCTTATTAGCCAAAGATAATAGTGTAAGGTTCAAGAGAGCAGTATTGCATTAAGAAAGAA
TTTTAATAGTTGAAAGGAGGTCTACTAAATACTTCATGCTAAAAAGCAATTAGCCAAGTA
TGCTTTTATTTATTTTAAAATTGTTAATGAATCTAAGATTATTTATTGTTAGTCATAAGC
AATTTTATTTCTTAATTGAATGAATTTTGAAATAATTTTATTTAAAATTTTTTACTTTTA
TATTCTATAGCTTAATCCACAAACTTACTGTAGATACTTTAAGGGAACTATGGATGAAAG
CAGAGATTTTTTTAAACTTAGAATGCCAGATATAGAGGACTTAAGAAGTGATGGATATAA
CAATAATTACTGTCCCTTTTATCATACCTAGAAAGTTAACAATGCAGTAGATGTTCTTTT
TCTTCCATATAACTATTTACTTGATAGAAATGTGATGAATTAAGCTAATATAAATATAAA
AAACGCTGTAATTATATTTGATGAAGCTCACAATATACACAAATCAGCAGAAGAAGGTTA
TTCTTTGTTTTTAAACTATTCTTCTTTGTGTGCTGCCGAAGCTGATTTGCTAAATCTTCT
TAAGTATATTGAAAATGGGTATGTAGATGACTAAAATAATTCAACTTCGCCTGCACCTTT
AGGTGCTGCAAAAAGAGGAACACCTATCAAAGAGTTAAGCGAATTCGACACAAAAAATTT
TACTAGCTCCTCATTTGACTGTAAGGCAATGCTTGGGCCGATTTAGGAATTAAGAAATTA
TTTTAAACAAATGGCCTTAAAATAGATAAGAGAAAATTAATAAAACTAGTATAATGAATA
CAACTGTGATAATATTTAGATTTAGAATGGTAAAGACATATTCGAATTGATCTAAATCCA
TACAAGAACATCAAAAGAATAAATTAATGAAAATTCTGTTGATAAATACATGAAGGCTCT
TGATAAATAAAAAGGCACATAATTTGTTTCATTTGAAAACGGATTGAGCTAAAGTAATTT
AGCATAATATATAGACAAAGCTTATAAAGCAATTAAAGACTTGAGTATAGGAGCTTCACA
TCATGGTCTAGAAACTTGGGTCAAATTCTTAGAAGGATTAAAAGATTTATGGACTAGTCA
CAATGAATTTAATTTAAAAACGAAAAAGTCAGACAATCCTTCATAGTTATGTTAAACTAA
TGATGTCATGCAAGACTATAAGCTTTATTTTGATTTAGAAGATCCAGAAAATCCATAATT
AAATCTTACTTGCCTTAATCCCAGCTTGAATTTCAAAAAAATTCTTCAGTAAGATCCTCA
TTGCTTACTTTTTACCTCAGGAACATTAAAACCATTTAATTTTTGGAAGACTGAGTTGCA
AATTCCATTTAACGTAATCCTTGAAAATAAGCATGTCATAGATTCGAAAAAGCAGCTTTT
TTCTGCTGTGATAAAAGGTAGACCTTCAAAATCATCTGTTATCACAACATATAAGCAAAC
CTTTAACTTTAGCTATGAAAAAAGAAAGGATTAAGATATGATTTTAGATCTTGGTAATGC
TCTAGCTGAACTTTTTGAAATTATTCCGAATGGTGTTTTAATCGTTTTTCCATCAAATTA
ACTAATGAATTAGTGTAGATCTTAATGGTCAAATTTCTTTTCTAATCAAAATAGCAACAA
TTAATAATAAAAAATATACAATCGCTTATTATCAAAGAAATTCATTTACTGGGAAGGAAA
AACTAATACTGAAACAATGAGTGCTATGTAAGATTTTAGATAAAAGTCAAAAACGTAAAA
AGGTTCTGCATTTTTTTGTGTAGCAAGAGGTAAAATTACAGAAGGTATTGACTTTGCTGA
TGAATCTGCAAGAGCAGTTATTTTAATAGGTAAATATTTAAAAAAATCTATTTAATTTTT
AACATATTTATTTTTTACTAGGCTTACCATATCCTCCACTTAAAAATATCAATATATAAG
TAAAAAAAGACTATTTAAATCAATAAAGTAAATTAAATTCTTAAAGAATAAATGGAAATG
AATGGTATGTGCAAGAAGCCATCAGAGCGATGAATTAATCCATTGGAAGAGTAATTAGGC
ATATTAACGACTGGGGAAGTGTTATATTTTTAGATGAAAGATTTGGACAATAAGATATAA
TAAAACACATGCCTTCTTGGTGCTTAACACAATAAATTGATTCATTTGATTAAGCTCTTA
TATAGTTATCGCAATTTTTTAGTGAGAAAAAAATGGCCTCTAAATAAAAATAAGAGGAGC
TAAGAAAATAAATTAACTTAAAGAAAAAAGATAATTTAGAATTAGAATAAGCAGAATAAT
AATCATTTAGTAATACATAAAAACCATAACATGGTATTTAAGTAGTTTAAAAAAGGGCTT
TTGATTTTACTTCTGTTAAAAGCTTATAAAATTAAATTTAGAAGCCTTAGAAACTTTTTA
AATAAAATATTTTAGTAAGCAAAGATGAGGAATCTCAAAAAAGTTACTAAACACTTGAAA
AACCAGTCTAAAATATAAAAAAGAATCCTTTTTGCTAATCATCTGATGATGAAGAAAACT
AACCTGAGTAAAAATTTTAAATAGTTAAACCTAGTTAATCAATAAAATAAGAAAATAATT
AAAATACTACTTCAAGCTAATTTGATTTTTCTAAGCCAATAAAAATAAAATCTTCTTAAG
ATAAAATTATGATTAAAAACGTCTCTTCTAATGTAAATAATTAACAAAATGTAATGAGTA
CAAAAAATTCTATTTACACAAATAAAATATTTTTTGAATCTTGA


>TTHERM_00684490(protein)
MNPNYPSIKVKQLAYQKKFIQRQDSFSSQTNENSQQSSKSFRSKDPVLENTPIHLNILHK
DKHTKLNINNIEVYFPHKPYDVQVVYMESVIKCLQERTHGLLESPTGTGKTLSMLCACLG
WLQQRREQQQGIKDIIPNRIIYCSRTHSQIQQVVKEIKTTAYQPKIIVQGSREQYCIKKE
FQQLKGGLLNTSCQKAISQLNPQTYCRYFKGTMDESRDFFKLRMPDIEDLRSDGYNNNYC
PFYHTQKVNNAVDVLFLPYNYLLDRNVMNQANINIKNAVIIFDEAHNIHKSAEEGYSLFL
NYSSLCAAEADLLNLLKYIENGYVDDQNNSTSPAPLGAAKRGTPIKELSEFDTKNFTSSS
FDCKAMLGPIQELRNYFKQMALKQIRENQQNQYNEYNCDNIQIQNGKDIFELIQIHTRTS
KEQINENSVDKYMKALDKQKGTQFVSFENGLSQSNLAQYIDKAYKAIKDLSIGASHHGLE
TWVKFLEGLKDLWTSHNEFNLKTKKSDNPSQLCQTNDVMQDYKLYFDLEDPENPQLNLTC
LNPSLNFKKILQQDPHCLLFTSGTLKPFNFWKTELQIPFNVILENKHVIDSKKQLFSAVI
KGRPSKSSVITTYKQTFNFSYEKRKDQDMILDLGNALAELFEIIPNGVLIVFPSNQLMNQ
CRSQWSNFFSNQNSNNQQQKIYNRLLSKKFIYWEGKTNTETMSAMQDFRQKSKTQKGSAF
FCVARGKITEGIDFADESARAVILIGLPYPPLKNINIQVKKDYLNQQSKLNSQRINGNEW
YVQEAIRAMNQSIGRVIRHINDWGSVIFLDERFGQQDIIKHMPSWCLTQQIDSFDQALIQ
LSQFFSEKKMASKQKQEELRKQINLKKKDNLELEQAEQQSFSNTQKPQHGIQVVQKRAFD
FTSVKSLQNQIQKPQKLFKQNILVSKDEESQKSYQTLEKPVQNIKKNPFCQSSDDEENQP
EQKFQIVKPSQSIKQENNQNTTSSQFDFSKPIKIKSSQDKIMIKNVSSNVNNQQNVMSTK
NSIYTNKIFFES