Identifiers and Description

Gene Model Identifier

TTHERM_00685930

Standard Name

MRNO36 (Membrane Occupation and Recognition Nexus protein other 36)

Aliases

PreTt18207 | 104.m00139 | 3732.m00052

Description

IQ calmodulin-binding motif protein; Protein with predicted MORN domains localized throughout the protein and/or associated with other domains having a predicted function; IQ calmodulin-binding motif family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_17378.1 9.997093137033517e-262
Description: IQ calmodulin-binding domain-containing protein family protein (353 aa)
Oxytricha Contig3828.0.g19 9.998819815181669e-76
Description: MORN repeat
Stentor Coeruleus SteCoe_16404 4.906094730649281e-35
Description: None
DictyBase DDB_G0349488 7.000255027549774e-17
Description: DDB_G0349488 on chromosome: 2 position 6912714 to 6914186
WormBase WBGene00002179 0.000000000010004361180063202
Description: locus:jph-1 status:Confirmed UniProt:Q22667 protein_id:CAA99924.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00685930(coding)
ATGGGAAGTTGCTAATCCGATTGCCGTGATAAATAGGAAATTGATCCTTATAATGTTCCA
AAAGAATAAGAACCATTAAAATTAGAAGATGCAGAATCTTAATAAAAAATTATTAAAATA
TAATCCTTCGCAAGAGGATACAAAGCTAAATAGGAAGTTTAAGAGCTGAAGAAATAAGTT
AACAGTAATGCTCCACCAAGAGAAGTTGCTCTTCCTTACGAAGGTCCTATGGCAACTGAT
AAACTCTAAGTATAAAAAATTTTGAATGATAAATTTAATTGGCCTGCAAGACCTGAATTC
AAGGAATTTATTCGCCTTCCTCCTTTTAAATTTATATAATCTGGTGCCATCTACAAAGGT
TAATGGAATAATGGTTTAAGACATGGAAGAGGTATATAATTTTGGCCAGATGGCTCTGTT
TATTAAGGTGATTGGGTCGAGGATATGGCAGATGGTAAAGGTAGACTCATTCATCCTGAT
GGAGATTACTACTAAGGTGATTGGTAAAAAGATCGCGCATAAGGCATAGGTATTTTTGTT
CACGTAGATGGAAATAAATATGAAGGTGAATGGTATTAAGATAAGTAACATGGCTAGGGA
GTAGAAGAATAGCAAGATTTTATTTATCGTGGTAGCTTCTAAAATGGCTTAAAGCATGGA
AAGGGAAAGATTATTTGGAAAAATGATGGAACTTCATACGAAGGTGATTTCTATGAAGGC
TTGATGGAAGGTACTGGTAGATTTATTTTCTAAAATGGAAAAATCTATAATGGTTAATGG
TTCAAATCTAAAATGCATGGACATGGAGAACTTATTTATCCTGATGGAAGAAAATATACA
GGAAGCTTTGTTGAAGGATAAAAAAATGGATTGGGTAAAATGGAATATCCAGATGGTAAA
ATTTATGAAGGTGAATGGAAAAATGGAAAATAGCATGGCCAAGGCTAGGTAACAACTCCA
GATGGTAGAATAGGTTAGGGTTACTGGGAAGAGGGCAAAAGAGTTAAGAATTACGATTAA
ATGAACTAATAACATTAAGAAGTAGGACTCTGA


>TTHERM_00685930(gene)
ATGGGAAGTTGCTAATCCGATTGCCGTGATAAATAGGAAATTGATCCTTATAATGTTCCA
AAAGAATAAGAACCATTAAAATTAGAAGATGCAGAATCTTAATAAAAAATTATTAAAATA
TAATCCTTCGCAAGAGGATACAAAGCTAAATAGGAAGTTTAAGAGCTGAAGAAATAAGTT
AACAGTAATGCTCCACCAAGAGAAGTTGCTCTTCCTTACGAAGGTCCTATGGCAACTGAT
AAACTCTAAGTATAAAAAATTTTGAATGATAAATTTAATTGGCCTGCAAGACCTGAATTC
AAGGAATTTATTCGCCTTCCTCCTTTTAAATTTATATAATCTGGTGCCATCTACAAAGGT
TAATGGAATAATGGTTTAAGACATGGAAGAGGTATATAATTTTGGCCAGATGGCTCTGTT
TATTAAGGTGATTGGGTCGAGGATATGGCAGATGGTAAAGGTAGACTCATTCATCCTGAT
GGAGATTACTACTAAGGTGATTGGTAAAAAGATCGCGCATAAGGCATAGGTAATTTTTTT
TCCATAAAAATGGAAAATTTAAACGCAAAGTTCAATATTCTATTAAGAGAATAAGATTAA
AAACTTATAAATGATATTAATATTTCATAAAAATCAAAAGAAAGGCATTTATTTCACTTT
ATTTTAAATTTTTTTGATATTTTATTCAGCCTTTATTTAAGTTTCAAAGATATAAAAATT
TTAAAATAGAAAAAATAATATGTTTGTTTAAGAGCATATTTTTTTACCTAATGCACATTC
TCTTACTTTTTGCTTCTATTTTCTATTCTCGTTTAAAATTTTTCAGCTTTCTTTACTCAA
CTTTTTAAATATATAATTTTATTTAAAATTAGGTATTTTTGTTCACGTAGATGGAAATAA
ATATGAAGGTGAATGGTATTAAGATAAGTAACATGGCTAGGGAGTAGAAGAATAGCAAGA
TTTTATTTATCGTGGTAGCTTCTAAAATGGCTTAAAGCATGGAAAGGGAAAGATTATTTG
GAAAAATGATGGAACTTCATACGAAGGTGATTTCTATGAAGGCTTGATGGAAGGTACTGG
TAGATTTATTTTCTAAAATGGAAAAATCTATAATGGTTAATGGTTCAAATCTAAAATGCA
TGGACATGGAGAACTTATTTATCCTGATGGAAGAAAATATACAGGTATATTAATTTCCTT
TTTCTTCTTAAAATATTTAGTTTTATATATTTTTAATTAGGAAGCTTTGTTGAAGGATAA
AAAAATGGATTGGGTAAAATGGAATATCCAGATGGTAAAATTTATGAAGGTGAATGGAAA
AATGGAAAATAGCATGGCCAAGGCTAGGTAACAACTCCAGATGGTAGAATAGGTTAGGGT
TACTGGGAAGAGGGCAAAAGAGTTAAGAATTACGATTAAATGAACTAATAACATTAAGAA
GTAGGACTCTGA


>TTHERM_00685930(protein)
MGSCQSDCRDKQEIDPYNVPKEQEPLKLEDAESQQKIIKIQSFARGYKAKQEVQELKKQV
NSNAPPREVALPYEGPMATDKLQVQKILNDKFNWPARPEFKEFIRLPPFKFIQSGAIYKG
QWNNGLRHGRGIQFWPDGSVYQGDWVEDMADGKGRLIHPDGDYYQGDWQKDRAQGIGIFV
HVDGNKYEGEWYQDKQHGQGVEEQQDFIYRGSFQNGLKHGKGKIIWKNDGTSYEGDFYEG
LMEGTGRFIFQNGKIYNGQWFKSKMHGHGELIYPDGRKYTGSFVEGQKNGLGKMEYPDGK
IYEGEWKNGKQHGQGQVTTPDGRIGQGYWEEGKRVKNYDQMNQQHQEVGL