Identifiers and Description

Gene Model Identifier

TTHERM_00686140

Standard Name

NAA50 (N-alpha-acetyltransferase 50)

Aliases

PreTt18228 | 104.m00160 | 3732.m00073

Description

acetyltransferase (GNAT) domain protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00583 ) acetyltransferase, GNAT family
  • ( TIGR01575 ) ribosomal-protein-alanine acetyltransferase

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_17401.1 2.000043494209831e-96
Description: acetyltransferase, GNAT family protein (155 aa)
Oxytricha Contig1188.1.g66 1.0002335610448659e-38
Description: Peptidase family M3
DictyBase DDB_G0295721 2.0003218023735366e-33
Description: naa50 on chromosome: 3 position 183263 to 183872
WormBase WBGene00018238 5.997292208647762e-33
Description: status:Confirmed UniProt:Q20220 protein_id:CCD70147.1
Stentor Coeruleus SteCoe_13038 0.00000000000003442477108469977
Description: None
SGD YPR131C 0.000005000363240844623
Description: NAT3 Catalytic subunit of the NatB N-terminal acetyltransferase, which catalyzes acetylation of the amino-terminal methionine residues of all proteins beginning with Met-Asp or Met-Glu and of some proteins beginning with Met-Asn or Met-Met

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00686140(coding)
ATGTCAGAAATAAAAGTTTAATTTGGTGACGTTAATGAAAAAAATTATGAATTGTTAAGA
ACTTTGAATTCTGTAACATTCCCAGTTTAGTACACTTTATCATTTTACAATAAGGTGTTG
ACTTATAACAAATACTCAAGGTTAGCTTTTTATAATGATATTCTTGTTGGAGCTATGACA
TGCAGACAAGAAGAAAAGGATGGATAATAAAGTCTTTATATTTTAACTATTGGAGTATTA
GATGCCTATAGAAAGCATAAAATTGGATCACAATTGATGGACGAATTATTAAAATTAGTT
AAACAAGATCCAGAAATTAAGTTTATTTATTTACACATGTAAGTGAACAACGAAGTTGGT
CTATAGTTTTACAAAAGATTTGGATTTGAAATTGCAGAAACTATAGATAATTATTACACT
GATATTAGTCCTAAAGCCTGTTATATTTTGAAAAAGATGCTTTGA


>TTHERM_00686140(gene)
ATGTCAGAAATAAAAGTTTAATTTGGTGACGTTAATGAAAAAAATTATGAATTGTTAAGA
ACTTTGAATTCTGTAACATTCCCAGTTTAGTACACTTTATCATTTTACAATAAGGTGTTG
ACTTATAACAAATACTCAAGGTTAGGTAAATAGCAGACATATTCATACATGAAATATTTC
AAATTATTAACTTCTACCAAGAAAATTAGCAAAATATTCATATTATTAATTAAGCAAAAT
ACCATTAATAATATTTCATTATTAACTCAATTCAAAATACTTATTCATATATTTAAAAAC
CGTTTTTATAATGATTATATCAATTTATTTTAATTATTTCTAGCTTTTTATAATGATATT
CTTGTTGGAGCTATGACATGCAGACAAGAAGAAAAGGATGGATAATAAAGTCTTTATATT
TTAACTATTGGAGTATTAGATGCCTATAGAAAGCATAAAATTGGTAATATATTCATTTTT
ATATAAACAATTAAAAGATATGTTTTTTTATAATTAAACTAATCCATAATTAATAAAATT
ATTATAGGATCACAATTGATGGACGAATTATTAAAATTAGTTAAACAAGATCCAGAAATT
AAGTTTATTTATTTACACATGTAAGTGAACAACGAAGTTGGTCTATAGTTTTACAAAAGA
TTTGGATTTGAAATTGCAGAAACTATAGATAATTATTACACTGATATTAGTCCTAAAGCC
TGTTATATTTTGAAAAAGATGCTTTGA


>TTHERM_00686140(protein)
MSEIKVQFGDVNEKNYELLRTLNSVTFPVQYTLSFYNKVLTYNKYSRLAFYNDILVGAMT
CRQEEKDGQQSLYILTIGVLDAYRKHKIGSQLMDELLKLVKQDPEIKFIYLHMQVNNEVG
LQFYKRFGFEIAETIDNYYTDISPKACYILKKML