Identifiers and Description

Gene Model Identifier

TTHERM_00688340

Standard Name

BBC39 (Basal Body Component 39)

Aliases

PreTt23129 | 105.m00096 | 3737.m00009

Description

BBC39 SF-assemblin/beta giardin protein; Kinetodesmal fiber protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

Domains

  • ( PF03304 ) Mlp lipoprotein family
  • ( PF06705 ) SF-assemblin/beta giardin

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_16677.1 6.002643599093603e-161
Description: hypothetical protein (251 aa)
Oxytricha Contig1313.1.g99 7.001220308967917e-48
Description: SF-assemblin/beta giardin
Stentor Coeruleus SteCoe_10857 5.242885663363464e-22
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00688340(coding)
ATGTCATTCAGAGTCTCTTCTCCCCACAACGAAAGAATAGCTAAAATTAGCGAAAAATTG
AGCCAAGTACAATCCAATGCTAATAATGATCGTTCTGCAAAATTAGATTAAGGCGAATAA
AGAATTAAATTGTTAGAAGATTCATACACTGAATTCGAAGAAAAGCTTGAAAAAAAAGTC
ACAACTATTAGAGAAACTATTTAAAAACTCTCCAAGCTTGTTTAAGAAGATAAGTTGAAC
AGAGAACATCATTTCGAGCAAAAACAAAAAGAAATTGCTTCTCTTGATCAAAAGCTTAGC
TCTGCCATCGAAAGTGAAATTGCATCAAGAAAAGAAGGTGAAAATAAAATTACTAGAGCC
ATAGATGAAAAGACAAGTGTTATTAGAGATGAAATTTCAAGAGAATCTAAAATCAGAAAT
GAAACTATTGAAGAAATCAACCGCAAGTTAGAAATTGAATTGCCCAAGCTCAGAGATGAA
GTTAATAACGAAAAAGTTCAAAGAGAGGAAATGGATTAAAATATTATGAAGAAGACCACT
GAAGAACTTGTAAAACTCACTAACATAATATAGTAAGAAAAGAAGGATAGAGAAGAAAGC
GAGTAATCTATATTTGATATGTTGAAAGAAGTAGTACACCGTGTAAAGACTGAAATCGAA
AATGAAAAGAAGAATAGAGAAATGACAGAAGAAACTCTTCTTGGTTTATTAGAAGACACT
TGCAACAAATTAAATGCTGCTGCCCTTGTTTGA


>TTHERM_00688340(gene)
ATGTCATTCAGAGGTTAGATATTTTTTTTATCCAAAAGAATATTTTAGCTTTGAGCTTAC
AAATTTATAAAAACCTTTATCTTAAAATATTTTAACCATTAAATTAACAGTCTCTTCTCC
CCACAACGAAAGAATAGCTAAAATTAGCGAAAAATTGAGCCAAGTACAATCCAATGCTAA
TAATGATCGTTCTGCAAAATTAGATTAAGGCGAATAAAGAATTAAATTGTTAGAAGATTC
ATACACTGAATTCGAAGAAAAGCTTGAAAAAAAAGTCACAACTATTAGAGAAACTATTTA
AAAACTCTCCAAGCTTGTTTAAGAAGATAAGTTGAACAGAGAACATCATTTCGAGCAAAA
ACAAAAAGAAATTGCTTCTCTTGATCAAAAGCTTAGCTCTGCCATCGAAAGTGAAATTGC
AGTAAACTAAAAATTTAAATAATTTTAAATTAGAATTTTAGCATAAGATTAATAAAGCAA
CAACACATAATCAATAATTTTATAAAAATGGATTTCGATTATAATTCTGTTTGATTATAC
TTTTAGTGCAAAAATGATTAGCTATTCTAACATTTATTATTATGAATTAAATAAAGTCAA
GAAAAGAAGGTGAAAATAAAATTACTAGAGCCATAGATGAAAAGACAAGTGTTATTAGAG
ATGAAATTTCAAGAGAATCTAAAATCAGAAATGAAACTATTGAAGAAATCAACCGCAAGT
TAGAAGTAATCATTTATTTCCTTATTTTTTGCTTACTTTCTTATACTCCTTAGTTAGATA
GCCATTAAATTTATTGAAACAAAGATTGTTAATACAAACAAATAGTTCAAAGATTTAAAA
TAAAAATTTGATAATCGGAGATATCTTATAAACATACATATAATTTACTTAGAATTTTGA
TAGAAATATTTAAATATATTTTTTCAACTAAAGATTGAATTGCCCAAGCTCAGAGATGAA
GTTAATAACGAAAAAGTTCAAAGAGAGGAAATGGATTAAAATATTATGAAGAAGACCACT
GAAGAACTTGTAAAACTCACTAACATAATATAGTAAGAAAAGAAGGATAGAGAAGAAAGC
GAGTAATCTATATTTGATATGTTGAAAGAAGTAGTACACCGTGTAAAGACTGAAATCGAA
AATGAAAAGAAGAATAGGTAAATCTTACTAATTAAATAGCAAATAAATAATTTAATTATA
TTTCTAAATTAAAAGAGAAATGACAGAAGAAACTCTTCTTGGTTTATTAGAAGACACTTG
CAACAAATTAAATGCTGCTGCCCTTGTTTGA


>TTHERM_00688340(protein)
MSFRVSSPHNERIAKISEKLSQVQSNANNDRSAKLDQGEQRIKLLEDSYTEFEEKLEKKV
TTIRETIQKLSKLVQEDKLNREHHFEQKQKEIASLDQKLSSAIESEIASRKEGENKITRA
IDEKTSVIRDEISRESKIRNETIEEINRKLEIELPKLRDEVNNEKVQREEMDQNIMKKTT
EELVKLTNIIQQEKKDREESEQSIFDMLKEVVHRVKTEIENEKKNREMTEETLLGLLEDT
CNKLNAAALV